From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002672000
  • symbol?: uvrB
  • description?: excinuclease ABC subunit B

      descriptions from strain specific annotations:

    • excinuclease ABC subunit B
    • excision endonuclease subunit UvrB
    • UvrABC system protein B
    • excinuclease ABC, B subunit
    • exinuclease ABC subunit B
  • strand?: +
  • coordinates?: 3167411..3168491
  • synteny block?: BlockID0019070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0823 (uvrB)
    N315:
    SA0713 (uvrB)
    NCTC8325:
    Newman:
    NWMN_0726 (uvrB)
    USA300_FPR3757:
    04-02981:
    SA2981_0736 (uvrB)
    08BA02176:
    C248_0845 (uvrB)
    11819-97:
    MS7_0808 (uvrB)
    71193:
    ST398NM01_0834
    ECT-R 2:
    ECTR2_708 (uvrB)
    ED133:
    SAOV_0795
    ED98:
    SAAV_0721 (uvrB)
    HO 5096 0412:
    SAEMRSA15_06840 (uvrB)
    JH1:
    SaurJH1_0799
    JH9:
    SaurJH9_0782
    JKD6008:
    SAA6008_00773 (uvrB)
    JKD6159:
    SAA6159_00713 (uvrB)
    LGA251:
    SARLGA251_06910 (uvrB)
    M013:
    M013TW_0745
    MRSA252:
    SAR0812 (uvrB)
    MSHR1132:
    SAMSHR1132_07030
    MSSA476:
    SAS0723
    Mu3:
    SAHV_0755 (uvrB)
    Mu50:
    SAV0758 (uvrB)
    MW2:
    MW0720 (uvrB)
    RF122:
    SAB0711 (uvrB)
    ST398:
    SAPIG0834 (uvrB)
    T0131:
    SAT0131_00830
    TCH60:
    HMPREF0772_12423 (uvrB)
    TW20:
    SATW20_08330 (uvrB)
    USA300_TCH1516:
    USA300HOU_0786 (uvrB)
    VC40:
    SAVC_03425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTMVEHYPFKIHSDFEPQGDQPQAIKEIVEGIKAGKRHQTLLGATGTGKTFTMSNVIKEV
    N315            MTMVEHYPFKIHSDFEPQGDQPQAIKEIVDGIKAGKRHQTLLGATGTGKTFTMSNVIKEV
    NCTC8325        --MVEHYPFKIHSDFEPQGDQPQAIKEIVEGIKAGKRHQTLLGATGTGKTFTMSNVIKEV
    Newman          --MVEHYPFKIHSDFEPQGDQPQAIKEIVEGIKAGKRHQTLLGATGTGKTFTMSNVIKEV
    USA300_FPR3757  --MVEHYPFKIHSDFEPQGDQPQAIKEIVEGIKAGKRHQTLLGATGTGKTFTMSNVIKEV
                      ***************************:******************************

    COL             GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDTFIEKDASIN
    N315            GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDTFIEKDASIN
    NCTC8325        GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDTFIEKDASIN
    Newman          GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDAFMEKDASIN
    USA300_FPR3757  GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDTFIEKDASIN
                    **************************************************:*:*******

    COL             DEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKL
    N315            DEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKL
    NCTC8325        DEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKL
    Newman          DEIDQVRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKL
    USA300_FPR3757  DEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKL
                    *****:******************************************************

    COL             VDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLK
    N315            VDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLK
    NCTC8325        VDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLK
    Newman          VDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLK
    USA300_FPR3757  VDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLK
                    ************************************************************

    COL             EREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEM
    N315            EREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEM
    NCTC8325        EREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEM
    Newman          EREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEM
    USA300_FPR3757  EREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEM
                    ************************************************************

    COL             MREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLVMIDESHVTLPQVRGMYNGDRA
    N315            MREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLVMIDESHVTLPQVRGMYNGDRA
    NCTC8325        MREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLGKVRTS----------------
    Newman          MREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLVMIDESHVTLPQVRGMYNGDRA
    USA300_FPR3757  MREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLVMIDESHVTLPQVRGMYNGDRA
                    **************************************  :  *                

    COL             RKQVLVDHGFRLPSALDNRPLKFEEFEEKTKQLVYVSATPGPYEIEHTDKMVEQIIRPTG
    N315            RKQVLVDHGFRLPSALDNRPLKFEEFEEKTKQLVYVSATPGPYEIEHTDKMVEQIIRPTG
    NCTC8325        ------------------------------------------------------------
    Newman          RKQVLVDHGFRLPSALDNRPLKFEEFEEKTKQLVYVSATPGPYEIEHTDKMVEQIIRPTG
    USA300_FPR3757  RKQVLVDHGFRLPSALDNRPLKFEEFEEKTKQLVYVSATPGPYEIEHTDKMVEQIIRPTG
                                                                                

    COL             LLDPKIEVRPTENQIDDLLSEIQTRVERNERVLVTTLTKKMSEDLTTYMKEAGIKVNYLH
    N315            LLDPKIEVRPTENQIDDLLSEIQTRVERNERVLVTTLTKKMSEDLTTYMKEAGIKVNYLH
    NCTC8325        ------------------------------------------------------------
    Newman          LLDPKIEVRPTENQIDDLLSEIQTRVERNERVLVTTLTKKMSEDLTTYMKEAGIKVNYLH
    USA300_FPR3757  LLDPKIEVRPTENQIDDLLSEIQTRVERNERVLVTTLTKKMSEDLTTYMKEAGIKVNYLH
                                                                                

    COL             SEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDIPEVSLVVILDADKEGFLRSNRSLIQ
    N315            SEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDIPEVSLVVILDADKEGFLRSNRSLIQ
    NCTC8325        ------------------------------------------------------------
    Newman          SEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDIPEVSLVVILDADKEGFLRSNRSLIQ
    USA300_FPR3757  SEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDIPEVSLVVILDADKEGFLRSNRSLIQ
                                                                                

    COL             TIGRAARNDKGEVIMYADKMTDSMKYAIDETQRRREIQMKHNEKHGITPKTINKKIHDLI
    N315            TIGRAARNDKGEVIMYADKMTDSMKYAIDETQRRREIQMKHNEKHGITPKTINKKIHDLI
    NCTC8325        ------------------------------------------------------------
    Newman          TIGRAARNDKGEVIMYADKMTDSMKYAIDETQRRREIQMKHNEKHGITPKTINKKIHDLI
    USA300_FPR3757  TIGRAARNDKGEVIMYADKMTDSMKYAIDETQRRREIQMKHNEKHGITPKTINKKIHDLI
                                                                                

    COL             SATVENDENNDKAQTVIPKKMTKKERQKTIDNIEKEMKQAAKDLDFEKATELRDMLFELK
    N315            SATVENDENNDKAQTVIPKKMTKKERQKTIDNIEKEMKQAAKDLDFEKATELRDMLFELK
    NCTC8325        ------------------------------------------------------------
    Newman          SATVENDENNDKAQTVIPKKMTKKERQKTIDNIEKEMKQAAKDLDFEKATELRDMLFELK
    USA300_FPR3757  SATVENDENNDKAQTVIPKKMTKKERQKTIDNIEKEMKQAAKDLDFEKATELRDMLFELK
                                                                                

    COL             AEG
    N315            AEG
    NCTC8325        --P
    Newman          AEG
    USA300_FPR3757  AEG