From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002626000
  • symbol?: queF
  • description?: 7-cyano-7-deazaguanine reductase

      descriptions from strain specific annotations:

    • 7-cyano-7-deazaguanine reductase
    • NADPH-dependent 7-cyano-7-deazaguanine reductase
    • NADPH dependent preQ0 reductase
    • GTP cyclohydrolase I family protein
    • preQ(1) synthase
    • NADPH-dependent 7-cyano-7-deazaguanine reductase (nadph-dependent nitrile oxidoreductase)
    • Queuosine biosynthesis protein
  • strand?: -
  • coordinates?: 3130691..3131192
  • synteny block?: BlockID0018610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0706
    08BA02176:
    C248_0815
    11819-97:
    MS7_0779 (queF)
    71193:
    ST398NM01_0805
    ECT-R 2:
    ECTR2_678 (queF)
    ED133:
    SAOV_0763c
    ED98:
    SAAV_0689
    HO 5096 0412:
    SAEMRSA15_06540
    JH1:
    SaurJH1_0769
    JH9:
    SaurJH9_0751
    JKD6008:
    SAA6008_00743 (folE)
    JKD6159:
    SAA6159_00683 (folE)
    LGA251:
    SARLGA251_06610 (queF)
    M013:
    M013TW_0714
    MRSA252:
    SAR0782
    MSHR1132:
    SAMSHR1132_06730
    MSSA476:
    SAS0693
    Mu3:
    SAHV_0725
    Mu50:
    SAV0728
    MW2:
    MW0690
    RF122:
    SAB0678c
    ST398:
    SAPIG0805
    T0131:
    SAT0131_00798
    TCH60:
    HMPREF0772_12457 (queF)
    TW20:
    SATW20_08030 (queF)
    USA300_TCH1516:
    USA300HOU_0752
    VC40:
    SAVC_03275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPIT
    N315            MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPIT
    NCTC8325        MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPIT
    Newman          MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPIT
    USA300_FPR3757  MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPIT
                    ************************************************************

    COL             GQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEV
    N315            GQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEV
    NCTC8325        GQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEV
    Newman          GQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEV
    USA300_FPR3757  GQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEV
                    ************************************************************

    COL             WGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR
    N315            WGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR
    NCTC8325        WGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR
    Newman          WGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR
    USA300_FPR3757  WGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR
                    **********************************************