From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002598000
  • symbol?: queC
  • description?: 7-cyano-7-deazaguanine synthase QueC

      descriptions from strain specific annotations:

    • 7-cyano-7-deazaguanine synthase QueC
    • exsB protein
    • queuosine biosynthesis protein Quec
    • 7-cyano-7-deazaguanine synthase
    • aluminum resistance protein
    • ExsB family post-transcriptional regulator
    • Queuosine biosynthesis protein
    • Queuosine Biosynthesis QueC ATPase
    • transcription regulator ExsB
  • strand?: -
  • coordinates?: 3108274..3108942
  • synteny block?: BlockID0018340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0689 (queC)
    08BA02176:
    C248_0796 (exsB)
    11819-97:
    MS7_0763 (queC)
    71193:
    ST398NM01_0789
    ECT-R 2:
    ECTR2_663
    ED133:
    SAOV_0746c
    ED98:
    SAAV_0674
    HO 5096 0412:
    SAEMRSA15_06380
    JH1:
    SaurJH1_0752
    JH9:
    SaurJH9_0736
    JKD6008:
    SAA6008_00728 (queC)
    JKD6159:
    SAA6159_00667 (queC)
    LGA251:
    SARLGA251_06450 (queC)
    M013:
    M013TW_0698
    MRSA252:
    SAR0765
    MSHR1132:
    SAMSHR1132_06570
    MSSA476:
    SAS0677
    Mu3:
    SAHV_0709
    Mu50:
    SAV0712
    MW2:
    MW0674
    RF122:
    SAB0661c
    ST398:
    SAPIG0789
    T0131:
    SAT0131_00782
    TCH60:
    HMPREF0772_12475 (exsB)
    TW20:
    SATW20_07870 (queC)
    USA300_TCH1516:
    USA300HOU_0735 (exsB)
    VC40:
    SAVC_03195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRHDTEIEVAKQIAQDQG
    N315            MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRHDTEIEVAKQIAQDQG
    NCTC8325        MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRHDTEIEVAKQIAQDQG
    Newman          MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRHDTEIEVAKQIAQDQG
    USA300_FPR3757  MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRHDTEIEVAKQIAQDQG
                    ************************************************************

    COL             MKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLLFLSFAGALAYQIGAKH
    N315            MKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLLFLSFAGALAYQIGAKH
    NCTC8325        MKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLLFLSFAGALAYQIGAKH
    Newman          MKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLLFLSFAGALAYQIGAKH
    USA300_FPR3757  MKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLLFLSFAGALAYQIGAKH
                    ************************************************************

    COL             IITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLMWLNKAETWKLSDELEVL
    N315            IITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLMWLNKAETWKLSDELEVL
    NCTC8325        IITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLMWLNKAETWKLSDELEVL
    Newman          IITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLMWLNKAETWKLSDELEVL
    USA300_FPR3757  IITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLMWLNKAETWKLSDELEVL
                    ************************************************************

    COL             DYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
    N315            DYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
    NCTC8325        DYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
    Newman          DYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
    USA300_FPR3757  DYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
                    ******************************************