From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • pan locus tag?: SAUPAN003080000
  • symbol: SA0830
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • symbol: SA0830
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 940904..941293
  • length: 390
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
    TTAAACATTTCAAAAAATCAAGGCGGATCACCATTTTTCAAACCGTTGCACATGATTTTA
    CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
    AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
    GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACAAAATGTTT
    TGGATAACAATGGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
    CCTATATCAAAATTATTCGGTATTGGCTAA
    60
    120
    180
    240
    300
    360
    390

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • symbol: SA0830
  • description: hypothetical protein
  • length: 129
  • theoretical pI: 11.181
  • theoretical MW: 14484.9
  • GRAVY: 1.02171

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.8)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 6.3)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsTetrapyrrolesCPO analysis Uncharacterized protein UPF0344 
  • PFAM:
    no clan definedDUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 120.9)
    SirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 20.6)
    GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 17.1)
    no clan definedDUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 13.7)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 12.1)
    DUF420; Protein of unknown function (DUF420) (PF04238; HMM-score: 8.3)
    DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 7.9)
    DUF4079; Protein of unknown function (DUF4079) (PF13301; HMM-score: 7.6)
    Ninjurin; Ninjurin (PF04923; HMM-score: 7.2)
    DUF5090; Domain of unknown function (DUF5090) (PF17009; HMM-score: 6.8)
    DUF2206; Predicted membrane protein (DUF2206) (PF09971; HMM-score: 6.7)
    DUF5467; Family of unknown function (DUF5467) (PF17555; HMM-score: 6.6)
    PalH; PalH/RIM21 (PF08733; HMM-score: 6.4)
    DUF1345; Protein of unknown function (DUF1345) (PF07077; HMM-score: 6.4)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 5.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.171
    • Ymax_pos: 27
    • Cmax: 0.264
    • Cmax_pos: 27
    • Smax: 0.278
    • Smax_pos: 4
    • Smean: 0.148
    • D: 0.162
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]