From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003080000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 3470090..3470479
  • synteny block?: BlockID0021880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0924
    08BA02176:
    C248_0971
    11819-97:
    MS7_0925
    71193:
    ST398NM01_0952
    ECT-R 2:
    ECTR2_825
    ED133:
    SAOV_0916
    ED98:
    SAAV_0930
    HO 5096 0412:
    SAEMRSA15_07990
    JH1:
    SaurJH1_0988
    JH9:
    SaurJH9_0969
    JKD6008:
    SAA6008_00922
    JKD6159:
    SAA6159_00828
    LGA251:
    SARLGA251_08870
    M013:
    M013TW_0888
    MRSA252:
    SAR0931
    MSHR1132:
    SAMSHR1132_08210
    MSSA476:
    SAS0839
    Mu3:
    SAHV_0964
    Mu50:
    SAV0969
    MW2:
    MW0851
    RF122:
    SAB0838
    ST398:
    SAPIG0952
    T0131:
    SAT0131_01002 (fabZ)
    TCH60:
    HMPREF0772_12277
    TW20:
    SATW20_09690
    USA300_TCH1516:
    USA300HOU_0928
    VC40:
    SAVC_04020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM
    N315            MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM
    NCTC8325        MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM
    Newman          MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM
    USA300_FPR3757  MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM
                    **************************** *******************************

    COL             NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG
    N315            NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG
    NCTC8325        NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG
    Newman          NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG
    USA300_FPR3757  NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG
                    *************************************.*****:****************

    COL             PISKLFGIG
    N315            PISKLFGIG
    NCTC8325        PISKLFGIG
    Newman          PISKLFGIG
    USA300_FPR3757  PISKLFGIG
                    *********