From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0832 [new locus tag: SA_RS04725 ]
  • pan locus tag?: SAUPAN003108000
  • symbol: SA0832
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0832 [new locus tag: SA_RS04725 ]
  • symbol: SA0832
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 942833..943657
  • length: 825
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCAACCACATTTAATATGTCTAGACTTAGACGGAACATTATTAAACGATAACAAAGAA
    ATTTCATCATATACTAAACAAGTATTAAATGAATTACAACAACGTGGACACCAAATTATG
    ATTGCGACTGGCAGACCTTATCGTGCAAGTCAAATGTATTATCATGAATTAAATTTAACG
    ACACCAATTGTTAATTTTAATGGCGCTTACGTACATCACCCTAAAGATAAAAACTTCAAA
    ACTTGCCATGAAATTTTAGATTTAGGCATCGCACAAAACATTATTCAAGGATTACAACAA
    TATCAAGTATCGAATATTATAGCAGAAGTGAAAGATTATGTTTTCATTAACAATCATGAT
    CCAAGATTATTTGAAGGTTTTTCAATGGGTAATCCAAGAATTCAAACTGGTAATTTACTT
    GTCCACTTGAAAGAATCCCCTACCTCAATTTTAATTGAAGCCGAAGAAAGTAAAATACCT
    GAAATCAAAAATATGCTTACTCATTTTTATGCCGATCATATTGAGCATCGACGCTGGGGC
    GCACCATTCCCTGTCATTGAAATTGTAAAACTTGGTATTAATAAAGCAAGAGGCATTGAG
    CAAGTTAGACAATTTTTAAATATTGACCGAAATAATATTATTGCATTCGGTGATGAAGAT
    AATGATATTGAAATGATTGAGTACGCCCGCCATGGTGTTGCTATGGAAAATGGTTTGCAA
    GAACTTAAAGATGTAGCGAACAATATTACATTCAACAATAATGAAGATGGCATTGGTCGA
    TATTTGAATGATTTCTTTAATTTAAATATTAGATATTACTGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    825

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0832 [new locus tag: SA_RS04725 ]
  • symbol: SA0832
  • description: hypothetical protein
  • length: 274
  • theoretical pI: 5.90828
  • theoretical MW: 31668.7
  • GRAVY: -0.419708

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 205.2)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIB (TIGR01484; HMM-score: 93.3)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 78)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 64.9)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 51)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 43.9)
    Unknown functionGeneralmannosyl-3-phosphoglycerate phosphatase homolog (TIGR02463; EC 3.1.3.-; HMM-score: 38)
    sucrose-phosphate synthase, sucrose phosphatase-like domain (TIGR02471; HMM-score: 31.3)
    MetabolismAmino acid biosynthesisSerine familyphosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 29.1)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 27.1)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 26.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 24)
    Unknown functionEnzymes of unknown specificityHAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 23.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IB (TIGR01490; HMM-score: 19.6)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 16.6)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIA (TIGR01460; HMM-score: 16.3)
    phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 14.5)
  • TheSEED:  
    FIG002540: Haloacid dehalogenase-like hydrolase 
  • PFAM:
    HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 216.4)
    S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 50.9)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 27.4)
    HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 25.8)
    HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 24.2)
    Trehalose_PPase; Trehalose-phosphatase (PF02358; HMM-score: 19.9)
    Acid_PPase; Acid Phosphatase (PF12689; HMM-score: 18.8)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 16.9)
    DUF2608; Protein of unknown function (DUF2608) (PF11019; HMM-score: 13.9)
    GT-B (CL0113) Glyco_trans_4_4; Glycosyl transferase 4-like domain (PF13579; HMM-score: 12.2)
    HAD (CL0137) Acid_phosphat_B; HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 24
    • Cmax: 0.126
    • Cmax_pos: 24
    • Smax: 0.18
    • Smax_pos: 20
    • Smean: 0.116
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLTTPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHDPRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWGAPFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]