From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003108000
  • symbol?:
  • description?: HAD family phosphatase

      descriptions from strain specific annotations:

    • HAD family phosphatase
    • HAD superfamily hydrolase
    • alpha/beta hydrolase
    • cof family hydrolase
    • cof-like hydrolase family protein
    • HAD hydrolase
    • haloacid dehalogenase
    • hydrolase, haloacid dehalogenase-like family
    • putative haloacid dehalogenase-like hydrolase
  • strand?: -
  • coordinates?: 3494153..3494977
  • synteny block?: BlockID0022010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0926
    08BA02176:
    C248_0997
    11819-97:
    MS7_0927
    71193:
    ST398NM01_0971
    ECT-R 2:
    ECTR2_827
    ED133:
    SAOV_0918c
    ED98:
    SAAV_0932
    HO 5096 0412:
    SAEMRSA15_08010
    JH1:
    SaurJH1_0990
    JH9:
    SaurJH9_0971
    JKD6008:
    SAA6008_00924
    JKD6159:
    SAA6159_00831
    LGA251:
    SARLGA251_08890
    M013:
    M013TW_0890
    MRSA252:
    SAR0934
    MSHR1132:
    SAMSHR1132_08230
    MSSA476:
    SAS0841
    Mu3:
    SAHV_0966
    Mu50:
    SAV0971
    MW2:
    MW0853
    RF122:
    SAB0840c
    ST398:
    SAPIG0971
    T0131:
    SAT0131_01004
    TCH60:
    HMPREF0772_12274 (yitU)
    TW20:
    SATW20_09710
    USA300_TCH1516:
    USA300HOU_0930
    VC40:
    SAVC_04030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
    N315            MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
    NCTC8325        MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
    Newman          MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
    USA300_FPR3757  MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
                    ************************************************************

    COL             TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
    N315            TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
    NCTC8325        TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
    Newman          TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
    USA300_FPR3757  TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
                    ************************************************************

    COL             PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
    N315            PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
    NCTC8325        PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
    Newman          PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
    USA300_FPR3757  PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
                    ************************************************************

    COL             APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
    N315            APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
    NCTC8325        APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
    Newman          APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
    USA300_FPR3757  APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
                    ************************************************************

    COL             ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC
    N315            ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC
    NCTC8325        ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC
    Newman          ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC
    USA300_FPR3757  ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC
                    **********************************