From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0936 [new locus tag: SA_RS05305 ]
  • pan locus tag?: SAUPAN003305000
  • symbol: SA0936
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0936 [new locus tag: SA_RS05305 ]
  • symbol: SA0936
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1062883..1063116
  • length: 234
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGTCAGAAATAATCGTTTATACGCAGAATGATTGTCCACCTTGTACATTTGTAAAAAAT
    TATCTAAATGAGCATCAAATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGA
    AACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGCAATCCA
    ATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0936 [new locus tag: SA_RS05305 ]
  • symbol: SA0936
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 3.96455
  • theoretical MW: 9187.19
  • GRAVY: -0.546753

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 45.7)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 37)
    MetabolismEnergy metabolismElectron transportglutaredoxin 3 (TIGR02181; HMM-score: 29.8)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 25.4)
    glutaredoxin-family domain (TIGR02190; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 19.2)
    glutaredoxin (TIGR02180; HMM-score: 17)
    Unknown functionGeneralredox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
  • TheSEED:  
    Nucleosides and NucleotidesNucleosides and Nucleotides - no subcategoryRibonucleotide reduction Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
    Stress ResponseOxidative stressGlutaredoxins Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
    Oxidative stressGlutathione: Redox cycle Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
  • PFAM:
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 38.1)
    DUF836; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 18.1)
    GST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 17.7)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 31
    • Cmax: 0.115
    • Cmax_pos: 67
    • Smax: 0.227
    • Smax_pos: 26
    • Smean: 0.141
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEIIVYTQNDCPPCTFVKNYLNEHQIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA0936 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]