From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003305000
  • symbol?:
  • description?: NrdH-redoxin

      descriptions from strain specific annotations:

    • NrdH-redoxin
    • glutaredoxin
    • glutaredoxin family protein
    • putative glutaredoxin
    • Redoxin faimily protein NrdH
    • glutaredoxin-like protein NrdH
  • strand?: -
  • coordinates?: 3676191..3676424
  • synteny block?: BlockID0023890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1041
    08BA02176:
    C248_1111
    11819-97:
    MS7_1042
    71193:
    ST398NM01_1082
    ECT-R 2:
    ECTR2_940
    ED133:
    SAOV_1029c
    ED98:
    SAAV_1050
    HO 5096 0412:
    SAEMRSA15_09150
    JH1:
    SaurJH1_1167
    JH9:
    SaurJH9_1145
    JKD6008:
    SAA6008_01040
    JKD6159:
    SAA6159_00941
    LGA251:
    SARLGA251_09980
    M013:
    M013TW_1017
    MRSA252:
    SAR1058
    MSHR1132:
    SAMSHR1132_09320
    MSSA476:
    SAS1020
    Mu3:
    SAHV_1077
    Mu50:
    SAV1085
    MW2:
    MW0967
    RF122:
    SAB0951c
    ST398:
    SAPIG1082
    T0131:
    SAT0131_01121 (ulaA)
    TCH60:
    HMPREF0772_12148
    TW20:
    SATW20_10800
    USA300_TCH1516:
    USA300HOU_1027
    VC40:
    SAVC_04585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNP
    N315            MSEIIVYTQNDCPPCTFVKNYLNEHQIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNP
    NCTC8325        MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNP
    Newman          MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNP
    USA300_FPR3757  MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNP
                    *************************:**********************************

    COL             MYHVDLDEINKVLNIQD
    N315            MYHVDLDEINKVLNIQD
    NCTC8325        MYHVDLDEINKVLNIQD
    Newman          MYHVDLDEINKVLNIQD
    USA300_FPR3757  MYHVDLDEINKVLNIQD
                    *****************