From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01030
  • pan locus tag?: SAUPAN003305000
  • symbol: SAOUHSC_01030
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01030
  • symbol: SAOUHSC_01030
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1000346..1000579
  • length: 234
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGTCAGAAATAATCGTTTATACGCAGAATGATTGTCCACCTTGTACATTTGTAAAAAAT
    TATCTAAATGAGCATCACATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGA
    AACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGCAATCCA
    ATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01030
  • symbol: SAOUHSC_01030
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 4.09175
  • theoretical MW: 9196.21
  • GRAVY: -0.542857

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 45.3)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 36.7)
    MetabolismEnergy metabolismElectron transportglutaredoxin 3 (TIGR02181; HMM-score: 29.4)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 23.4)
    glutaredoxin-family domain (TIGR02190; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 18.9)
    glutaredoxin (TIGR02180; HMM-score: 16.5)
    Unknown functionGeneralredox-active disulfide protein 1 (TIGR00411; HMM-score: 12.8)
  • TheSEED:  
    Nucleosides and NucleotidesNucleosides and Nucleotides - no subcategoryRibonucleotide reduction Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
    Stress ResponseOxidative stressGlutaredoxins Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
    Oxidative stressGlutathione: Redox cycle Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib 
  • PFAM:
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 37.3)
    DUF836; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 19)
    GST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 17.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.14
    • Ymax_pos: 31
    • Cmax: 0.115
    • Cmax_pos: 67
    • Smax: 0.214
    • Smax_pos: 26
    • Smean: 0.142
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_01030 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Inbal Rabinovitch, Michaela Yanku, Adva Yeheskel, Gerald Cohen, Ilya Borovok, Yair Aharonowitz
Staphylococcus aureus NrdH redoxin is a reductant of the class Ib ribonucleotide reductase.
J. Bacteriol.: 2010, 192(19);4963-72
[PubMed:20675493] [WorldCat.org] [DOI] (I p)