From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1007 [new locus tag: SA_RS05730 ]
  • pan locus tag?: SAUPAN003418000
  • symbol: SA1007
  • pan gene symbol?: hla
  • synonym:
  • product: alpha-hemolysin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1007 [new locus tag: SA_RS05730 ]
  • symbol: SA1007
  • product: alpha-hemolysin
  • replicon: chromosome
  • strand: -
  • coordinates: 1140562..1141521
  • length: 960
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAACACGTATAGTCAGCTCAGTAACAACAACACTATTGCTAGGTTCCATATTAATG
    AATCCTGTCGCTAATGCCGCAGATTCTGATATTAATATTAAAACCGGTACTACAGATATT
    GGAAGCAATACTACAGTAAAAACAGGTGATTTAGTCACTTATGATAAAGAAAATGGCATG
    CACAAAAAAGTATTTTATAGTTTTATCGATGATAAAAATCACAATAAAAAACTGCTAGTT
    ATTAGAACGAAAGGTACCATTGCTGGTCAATATAGAGTTTATAGCGAAGAAGGTGCTAAC
    AAAAGTGGTTTAGCCTGGCCTTCAGCCTTTAAGGTACAGTTGCAACTACCTGATAATGAA
    GTAGCTCAAATATCTGATTACTATCCAAGAAATTCGATTGATACAAAAGAGTATATGAGT
    ACTTTAACTTATGGATTCAACGGTAATGTTACTGGTGATGATACAGGAAAAATTGGCGGC
    CTTATTGGTGCAAATGTTTCGATTGGTCATACACTGAAATATGTTCAACCTGATTTCAAA
    ACAATTTTAGAGAGCCCAACTGATAAAAAAGTAGGCTGGAAAGTGATATTTAACAATATG
    GTGAATCAAAATTGGGGACCATATGATAGAGATTCTTGGAACCCGGTATATGGCAATCAA
    CTTTTCATGAAAACTAGAAATGGTTCTATGAAAGCAGCAGAGAACTTCCTTGATCCTAAC
    AAAGCAAGTTCTCTATTATCTTCAGGGTTTTCACCAGACTTCGCTACAGTTATTACTATG
    GATAGAAAAGCATCCAAACAACAAACAAATATAGATGTAATATACGAACGAGTTCGTGAT
    GACTACCAATTGCATTGGACTTCAACAAATTGGAAAGGTACCAATACTAAAGATAAATGG
    ACAGATCGTTCTTCAGAAAGATATAAAATCGATTGGGAAAAAGAAGAAATGACAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1007 [new locus tag: SA_RS05730 ]
  • symbol: SA1007
  • description: alpha-hemolysin
  • length: 319
  • theoretical pI: 9.18585
  • theoretical MW: 35975.1
  • GRAVY: -0.662069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistancebeta-channel forming cytolysin (TIGR01002; HMM-score: 437.6)
    CXXX repeat peptide modification system protein (TIGR04116; HMM-score: 12)
  • TheSEED:  
    Staphylococcus Two-component and Pore-forming Cytolysins Cytolytic pore-forming protein => Alpha-hemolysin 
  • PFAM:
    Leukocidin (CL0636) Leukocidin; Leukocidin/Hemolysin toxin family (PF07968; HMM-score: 277.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: PVANAADS
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.811
    • Ymax_pos: 27
    • Cmax: 0.755
    • Cmax_pos: 27
    • Smax: 0.909
    • Smax_pos: 18
    • Smean: 0.857
    • D: 0.829
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTRIVSSVTTTLLLGSILMNPVANAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAAENFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA1007 no polycistronic organisation predicted

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Saumya S Srivastava, Satyabrata Pany, Amita Sneh, Neesar Ahmed, Aejazur Rahman, Krishnasastry V Musti
Membrane bound monomer of Staphylococcal alpha-hemolysin induces caspase activation and apoptotic cell death despite initiation of membrane repair pathway.
PLoS ONE: 2009, 4(7);e6293
[PubMed:19621082] [WorldCat.org] [DOI] (I e)
Anne F Hammerstein, Lakmal Jayasinghe, Hagan Bayley
Subunit dimers of alpha-hemolysin expand the engineering toolbox for protein nanopores.
J. Biol. Chem.: 2011, 286(16);14324-34
[PubMed:21324910] [WorldCat.org] [DOI] (I p)
Takaki Sugawara, Daichi Yamashita, Yoshikazu Tanaka, Jun Kaneko, Yoshiyuki Kamio, Isao Tanaka, Min Yao
Preliminary X-ray crystallographic study of staphylococcal α-haemolysin monomer.
Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun.: 2013, 69(Pt 8);868-70
[PubMed:23908030] [WorldCat.org] [DOI] (I p)