From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1205 [new locus tag: SA_RS06850 ]
  • pan locus tag?: SAUPAN003768000
  • symbol: trpA
  • pan gene symbol?: trpA
  • synonym:
  • product: tryptophan synthase subunit alpha

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1205 [new locus tag: SA_RS06850 ]
  • symbol: trpA
  • product: tryptophan synthase subunit alpha
  • replicon: chromosome
  • strand: +
  • coordinates: 1378154..1378882
  • length: 729
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACTAAATTATTTATACCTTATATTATGGGCAATAAAGATTTGATTGAAAATGCAACA
    TTGTTGAGTGAAAATGGTGCAGATATAATTGAAATTGGTGTACCTTTCTCTGATCCGGTT
    GCTGATGGTCCAGTTATCATGGAAGCAGGTCAACAAGCGATTAAACAAGGCATCACGATA
    GATTATATTTTCAATCAATTAGAAAAACATGGTGATCAAATTAAGTGTAACTATGTATTA
    ATGACGTATTATAATATTATTTGTCATTATGGAGAACAAGCGTTTTTTGAAAAATGTCGA
    GATACTGGTGTCTACGGCTTAATTATTCCTGATTTACCATATGAATTATCGCAGCGTTTA
    AAACAACAATTTAGTCACTATGGCGTCAAAATCATATCGTTAGTTGCGATGACTACTGAT
    GACAAACGTATAAAAGATATCGTATCTCATGCGGAAGGCTTTATTTATACTGTGACGATG
    AATGCGACAACAGGACAAAACGGTGCGTTTCATCCAGAATTAAAACGAAAAATTGAGTCA
    ATTAAAGCGATAGCCAATGTGCCAGTTGTCGCAGGATTTGGTATAAGAACACCACAACAT
    GTTGCAGATATAAAAGAGGTTGCAGATGGCATCGTCATTGGTAGCGAAATCGTTAAGCGA
    TTTAAATCTAACACGCGTGAGGAAATCATTAGATATTTACAATCTATCCAACAAACATTG
    AATAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1205 [new locus tag: SA_RS06850 ]
  • symbol: TrpA
  • description: tryptophan synthase subunit alpha
  • length: 242
  • theoretical pI: 6.24515
  • theoretical MW: 27145.1
  • GRAVY: -0.0909091

Function[edit source | edit]

  • reaction:
    EC 4.2.1.20?  ExPASy
    Tryptophan synthaseL-serine + 1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + D-glyceraldehyde 3-phosphate + H2O
  • TIGRFAM:
    MetabolismAmino acid biosynthesisAromatic amino acid familytryptophan synthase, alpha subunit (TIGR00262; EC 4.2.1.20; HMM-score: 209.6)
    MetabolismAmino acid biosynthesisHistidine familyimidazoleglycerol phosphate synthase, cyclase subunit (TIGR00735; HMM-score: 17.4)
    Genetic information processingProtein fateProtein folding and stabilizationmembrane complex biogenesis protein, BtpA family (TIGR00259; HMM-score: 16.8)
    Cellular processesCellular processesSporulation and germinationstage II sporulation protein M (TIGR02831; HMM-score: 13.6)
    geranylgeranylglyceryl phosphate synthase family protein (TIGR01768; EC 2.5.1.-; HMM-score: 13.5)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesTryptophan synthesis Tryptophan synthase alpha chain (EC 4.2.1.20) 
  • PFAM:
    TIM_barrel (CL0036) Trp_syntA; Tryptophan synthase alpha chain (PF00290; HMM-score: 248.7)
    BtpA; BtpA family (PF03437; HMM-score: 18.3)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 16.2)
    DUF561; Protein of unknown function (DUF561) (PF04481; HMM-score: 15.8)
    IGPS; Indole-3-glycerol phosphate synthase (PF00218; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 19
    • Cmax: 0.11
    • Cmax_pos: 42
    • Smax: 0.203
    • Smax_pos: 11
    • Smean: 0.141
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITIDYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRLKQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIESIKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIRYLQSIQQTLNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: T-box(Trp), CodY
    T-box(Trp) (RNA) important in Amino acid metabolismRegPrecise
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]