From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1497 [new locus tag: SA_RS08425 ]
  • pan locus tag?: SAUPAN004288000
  • symbol: engB
  • pan gene symbol?: engB
  • synonym:
  • product: ribosome biogenesis GTP-binding protein YsxC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1497 [new locus tag: SA_RS08425 ]
  • symbol: engB
  • product: ribosome biogenesis GTP-binding protein YsxC
  • replicon: chromosome
  • strand: -
  • coordinates: 1705397..1705987
  • length: 591
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGTTAATCCTAATAATATTGAATTAATCATTAGTGCAGTAAAAGAAGAACAATAT
    CCAGAAACAGAATTGTCTGAAGTTGCACTGAGCGGTCGATCTAATGTAGGTAAGTCTACA
    TTTATCAATAGTATGATTGGCAGAAAAAATATGGCACGTACATCACAGCAACCCGGCAAA
    ACGCAAACGTTAAATTTTTATAATATAGATGAACAACTTATTTTTGTGGATGTTCCAGGG
    TATGGATATGCTAAAGTAAGTAAAACACAACGTGAAAAATTTGGGAAAATGATTGAGGAA
    TATATAACTAAGAGAGAGAATTTGCAATTAGTTATTCAATTAGTTGATTTAAGACATGAT
    CCAACACAAGATGATATCTTAATGTACAATTATTTGAAACATTTTGATATTCCTACTTTA
    GTTATATGCACTAAAGAAGACAAAATTCCAAAAGGTAAAGTTCAAAAGCATATTAAAAAT
    ATTAAGACACAATTAGATATGGACCCAGACGATACAATTGTAAGTTATTCATCAATTCAA
    AATAATAAACAACAACAAATATGGAATTTAATTGAACCGTATATTTCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1497 [new locus tag: SA_RS08425 ]
  • symbol: EngB
  • description: ribosome biogenesis GTP-binding protein YsxC
  • length: 196
  • theoretical pI: 7.58416
  • theoretical MW: 22684.8
  • GRAVY: -0.585204

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 225.8)
    Genetic information processingProtein synthesisOtherGTP-binding protein Era (TIGR00436; HMM-score: 63.9)
    Genetic information processingProtein synthesisOtherribosome-associated GTPase EngA (TIGR03594; HMM-score: 60.6)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 50.3)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 41.3)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 37)
    Genetic information processingProtein fateProtein modification and repair[FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 35.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 33.1)
    Genetic information processingProtein synthesisOtherObg family GTPase CgtA (TIGR02729; HMM-score: 28)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 23.8)
    Unknown functionGeneralGTP-binding protein HflX (TIGR03156; HMM-score: 19.7)
    Genetic information processingProtein synthesisTranslation factorsribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and amineschloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 14)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.9)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisUniversal GTPases GTP-binding protein EngB 
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 74.9)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 37.6)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 30.7)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.9)
    AIG1; AIG1 family (PF04548; HMM-score: 20.9)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 16.5)
    IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15.2)
    Septin; Septin (PF00735; HMM-score: 15.2)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 14.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 13.8)
    ABC_tran; ABC transporter (PF00005; HMM-score: 13.3)
    Cyclin (CL0065) RB_B; Retinoblastoma-associated protein B domain (PF01857; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.149
    • Ymax_pos: 53
    • Cmax: 0.145
    • Cmax_pos: 53
    • Smax: 0.246
    • Smax_pos: 50
    • Smean: 0.13
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNNKQQQIWNLIEPYIS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]