From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01777
  • pan locus tag?: SAUPAN004288000
  • symbol: engB
  • pan gene symbol?: engB
  • synonym:
  • product: ribosome biogenesis GTP-binding protein YsxC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01777
  • symbol: engB
  • product: ribosome biogenesis GTP-binding protein YsxC
  • replicon: chromosome
  • strand: -
  • coordinates: 1677130..1677720
  • length: 591
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGTTAATCCTAATAATATAGAATTAATCATTAGTGCAGTAAAAGAAGAACAATAT
    CCAGAAACAGAATTGTCTGAAGTTGCACTGAGCGGTCGATCTAATGTAGGTAAGTCTACA
    TTTATCAATAGTATGATTGGCAGAAAAAATATGGCACGTACATCACAGCAACCCGGCAAA
    ACGCAAACGTTAAATTTTTATAATATAGATGAACAACTTATTTTTGTGGATGTTCCAGGG
    TATGGATATGCTAAAGTAAGTAAAACACAACGTGAAAAATTTGGGAAAATGATTGAGGAA
    TATATAACTAAGAGAGAGAATTTGCAATTAGTTATTCAATTAGTTGATTTAAGACATGAT
    CCAACACAAGATGATATCTTAATGTACAATTATTTGAAACATTTTGATATTCCTACTTTA
    GTTATATGCACTAAAGAAGACAAAATTCCAAAAGGTAAGGTTCAAAAGCATATTAAAAAT
    ATTAAGACACAATTAGATATGGACCCAGACGATACAATTGTAAGTTATTCATCAATTCAA
    AATAATAAACAACAACAAATATGGAATTTAATTGAACCGTATATTTCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01777
  • symbol: EngB
  • description: ribosome biogenesis GTP-binding protein YsxC
  • length: 196
  • theoretical pI: 7.58416
  • theoretical MW: 22684.8
  • GRAVY: -0.585204

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 225.8)
    Genetic information processingProtein synthesisOtherGTP-binding protein Era (TIGR00436; HMM-score: 63.9)
    Genetic information processingProtein synthesisOtherribosome-associated GTPase EngA (TIGR03594; HMM-score: 60.6)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 50.3)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 41.3)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 37)
    Genetic information processingProtein fateProtein modification and repair[FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 35.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 33.1)
    Genetic information processingProtein synthesisOtherObg family GTPase CgtA (TIGR02729; HMM-score: 28)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 23.8)
    Unknown functionGeneralGTP-binding protein HflX (TIGR03156; HMM-score: 19.7)
    Genetic information processingProtein synthesisTranslation factorsribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and amineschloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 14)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.9)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisUniversal GTPases GTP-binding protein EngB 
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 74.9)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 37.6)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 30.7)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.9)
    AIG1; AIG1 family (PF04548; HMM-score: 20.9)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 16.5)
    IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15.2)
    Septin; Septin (PF00735; HMM-score: 15.2)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 14.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 13.8)
    ABC_tran; ABC transporter (PF00005; HMM-score: 13.3)
    Cyclin (CL0065) RB_B; Retinoblastoma-associated protein B domain (PF01857; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.149
    • Ymax_pos: 53
    • Cmax: 0.145
    • Cmax_pos: 53
    • Smax: 0.246
    • Smax_pos: 50
    • Smean: 0.13
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNNKQQQIWNLIEPYIS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Elizabeth L Cooper, Jorge García-Lara, Simon J Foster
YsxC, an essential protein in Staphylococcus aureus crucial for ribosome assembly/stability.
BMC Microbiol.: 2009, 9;266
[PubMed:20021644] [WorldCat.org] [DOI] (I e)