From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004288000
  • symbol?: engB
  • description?: ribosome biogenesis GTP-binding protein YsxC

      descriptions from strain specific annotations:

    • ribosome biogenesis GTP-binding protein YsxC
    • GTP-binding protein
    • GTP-binding protein EngB
    • probable GTP-binding protein EngB
    • putative GTP-binding protein
  • strand?: -
  • coordinates?: 4532561..4533151
  • synteny block?: BlockID0033120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1720 (engB)
    N315:
    SA1497 (engB)
    NCTC8325:
    Newman:
    NWMN_1567 (engB)
    USA300_FPR3757:
    04-02981:
    SA2981_1633 (engB)
    08BA02176:
    C248_1714
    11819-97:
    MS7_1681 (ysxC)
    71193:
    ST398NM01_1728
    ECT-R 2:
    ECTR2_1514
    ED133:
    SAOV_1662
    ED98:
    SAAV_1660 (engB)
    HO 5096 0412:
    SAEMRSA15_15840
    JH1:
    SaurJH1_1765 (engB)
    JH9:
    SaurJH9_1731 (engB)
    JKD6008:
    SAA6008_01641 (engB)
    JKD6159:
    SAA6159_01598 (engB)
    LGA251:
    SARLGA251_15660
    M013:
    M013TW_1687
    MRSA252:
    SAR1753 (engB)
    MSHR1132:
    SAMSHR1132_15010
    MSSA476:
    SAS1602 (engB)
    Mu3:
    SAHV_1660 (engB)
    Mu50:
    SAV1673 (engB)
    MW2:
    MW1617 (engB)
    RF122:
    SAB1533c (engB)
    ST398:
    SAPIG1728
    T0131:
    SAT0131_01775
    TCH60:
    HMPREF0772_11477 (ysxC)
    TW20:
    SATW20_16640
    USA300_TCH1516:
    USA300HOU_1665 (engB)
    VC40:
    SAVC_07575 (engB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
    N315            MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
    NCTC8325        MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
    Newman          MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
    USA300_FPR3757  MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
                    ************************************************************

    COL             TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
    N315            TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
    NCTC8325        TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
    Newman          TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
    USA300_FPR3757  TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
                    ************************************************************

    COL             PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
    N315            PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
    NCTC8325        PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
    Newman          PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
    USA300_FPR3757  PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
                    ************************************************************

    COL             NNKQQQIWNLIEPYIS
    N315            NNKQQQIWNLIEPYIS
    NCTC8325        NNKQQQIWNLIEPYIS
    Newman          NNKQQQIWNLIEPYIS
    USA300_FPR3757  NNKQQQIWNLIEPYIS
                    ****************