From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1693 [new locus tag: SA_RS09720 ]
  • pan locus tag?: SAUPAN004862000
  • symbol: SA1693
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1693 [new locus tag: SA_RS09720 ]
  • symbol: SA1693
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1940751..1941902
  • length: 1152
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGAATAGCGTCAAATTGAAGCAACCTGTTAGCATTTACAATGATCCATGGGAATCATAT
    AACGATGTTAAAGAACATGGCCAATTAACTTTAAGTAACATCGAATTTACAACTACAAAT
    CTTTGTAATATGCGTTGTAGCCACTGTGCAGTTGGTTATACTTTACAAACTGTCGACCCC
    GAGCCTTTAGATATGGACTTAATTTATCGTAGACTTGATGAAATTCCAAATCTGCGAACG
    ATGTCAATTACAGGTGGCGAACCAATGTTTTCTAAAAAGTCTATTAGAAATGTTGTTAAA
    CCTCTATTAAAGTATGCACATCATCGAGGTATATATACACAAATGAATTCAAACCTAACA
    TTGCCTCAAGATCGTTATTTAGATATTGCTGAATATATCGATGTTATGCATATCTCACAT
    AACTGGGGAACAACTGATGAATTCGCAAATGTTGGCTTTGGCGCAATGAAGAAGCAACCA
    CCGTTAAAAGCTAAGTTAAAATTATATGAACAAATGATTTCGAATGCACGTACATTATCA
    GAACAAGGAATGTTTGTATCTGCGGAAACAATGCTCAATCAAAGTACGCTACCACATTTA
    CGAAAAATACATCAAGAAGTCGTTCATGATATGAAATGTAGCAGACACGAGATTCACCCT
    ATGTATCCAGCTGACTTTGCAAGTCAATTAAATGTGTTAACTCTAGCGGAAATGAAAAAG
    ACAATTCATGATATATTGGATTTCAGAGATGAAGATATTTGGATGTTATTTGGTACTTTG
    CCTGTGTTTCCATGCTTAAAGGATGATGAAGATCAAAAGTTACTATCACGTTTAAGAAAT
    GCTAACAATGTAACGACTAGAAATGACCCGGATGGCCGTAGTCGTTTAAATGTCAATGTA
    TTTACAGGTAATGTAATCGTAACTGATTTCGGAGATGAAACAGGTACAATTTCGAATATA
    CAAAAAGATAAATTAACAGATGTATTTGATAAATGGTTATCCTCTGATCTTGCTAAATCA
    TTAAATTGTCATTGTTCCGAGTTTAGTTGTTTAGGACCAAATGTTCTTGTTAAAAATATG
    TACTATCCGAATATGGATTTTAAAGATAATGAGCGTCATATGCACAAACAACCACAAATT
    ATACAATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1152

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1693 [new locus tag: SA_RS09720 ]
  • symbol: SA1693
  • description: hypothetical protein
  • length: 383
  • theoretical pI: 6.67188
  • theoretical MW: 44167.2
  • GRAVY: -0.484073

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityradical SAM/CxCxxxxC motif protein YfkAB (TIGR04478; HMM-score: 612.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationputative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 27.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 27.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 24.7)
    radical SAM/Cys-rich domain protein (TIGR04167; HMM-score: 24.6)
    Cellular processesCellular processesToxin production and resistanceCys-rich peptide radical SAM maturase CcpM (TIGR04068; HMM-score: 24.5)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 24.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    Unknown functionEnzymes of unknown specificityradical SAM protein, BA_1875 family (TIGR04053; HMM-score: 23.4)
    hopanoid biosynthesis associated radical SAM protein HpnH (TIGR03470; HMM-score: 23.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 22.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 21.8)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 20.5)
    Genetic information processingProtein synthesistRNA and rRNA base modification7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 19.6)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 19.2)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 18.8)
    Unknown functionEnzymes of unknown specificitymycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 17.9)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 17.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 17.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.2)
    radical SAM/SPASM domain protein maturase (TIGR04463; HMM-score: 16.9)
    Genetic information processingProtein fateProtein modification and repairpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 16.7)
    MetabolismEnergy metabolismAnaerobicpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 16.7)
    radical SAM protein, TatD family-associated (TIGR04038; HMM-score: 16.7)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 16.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 16.6)
    Unknown functionEnzymes of unknown specificityarchaeal radical SAM protein, PTO1314 family (TIGR03961; HMM-score: 16.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinprobable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 16.2)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 16)
    Signal transductionRegulatory functionsProtein interactionspeptide modification radical SAM enzyme, YydG family (TIGR04078; HMM-score: 15.7)
    putative geopeptide radical SAM maturase (TIGR04280; HMM-score: 15.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 15.2)
    radical SAM peptide maturase, GG-Bacteroidales family (TIGR04148; HMM-score: 14.8)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 14.3)
    GeoRSP system radical SAM/SPASM protein (TIGR04303; HMM-score: 14.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit (TIGR03551; EC 2.5.1.77; HMM-score: 13.2)
    Cellular processesCellular processesAdaptations to atypical conditionsglutamate 2,3-aminomutase (TIGR04368; EC 5.4.3.9; HMM-score: 13.2)
    putative peptide-modifying radical SAM enzyme, AF0577 family (TIGR04084; HMM-score: 12.8)
  • TheSEED:  
    CBSS-176280.1.peg.1561 Uncharacterized radical SAM protein YfkA 
  • PFAM:
    no clan definedYfkB; YfkB-like domain (PF08756; HMM-score: 249.8)
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 44.3)
    4Fe-4S (CL0344) Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 24.4)
    Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 23.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 50
    • Cmax: 0.162
    • Cmax_pos: 50
    • Smax: 0.243
    • Smax_pos: 47
    • Smean: 0.117
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNSVKLKQPVSIYNDPWESYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDPEPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLTLPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLSEQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKKTIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNANNVTTRNDPDGRSRLNVNVFTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNMYYPNMDFKDNERHMHKQPQIIQF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA1693 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]