From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004862000
  • symbol?:
  • description?: radical SAM/CxCxxxxC motif protein YfkAB

      descriptions from strain specific annotations:

    • radical SAM/CxCxxxxC motif protein YfkAB
    • conserved protein YfkA
    • dehydrogenase
    • putative Fe-S oxidoreductase
    • radical SAM superfamily domain protein
    • radical SAM superfamily protein
    • Thioredoxin-like oxidoreductase
  • strand?: +
  • coordinates?: 5067361..5076794
  • synteny block?: BlockID0037910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1833
    08BA02176:
    C248_1949
    11819-97:
    MS7_1912
    71193:
    ST398NM01_1970
    ECT-R 2:
    ECTR2_1748
    ED133:
    SAOV_1975
    ED98:
    SAAV_1927
    HO 5096 0412:
    SAEMRSA15_17840
    JH1:
    SaurJH1_1965
    JH9:
    SaurJH9_1931
    JKD6008:
    SAA6008_01897
    JKD6159:
    SAA6159_01808
    LGA251:
    SARLGA251_17590
    M013:
    M013TW_1913
    MRSA252:
    SAR1967
    MSHR1132:
    SAMSHR1132_17220
    MSSA476:
    SAS1799
    Mu3:
    SAHV_1862
    Mu50:
    SAV1877
    MW2:
    MW1817
    RF122:
    SAB1809
    ST398:
    SAPIG1970
    T0131:
    SAT0131_02000
    TCH60:
    HMPREF0772_11267
    TW20:
    SATW20_18710
    USA300_TCH1516:
    USA300HOU_1872
    VC40:
    SAVC_08640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSVKLKQPVSIYNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDP
    N315            MNSVKLKQPVSIYNDPWESYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDP
    NCTC8325        MRNN--KPKISIQNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDP
    Newman          MRNN--KPKIRIHNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDP
    USA300_FPR3757  MNSVKLKQPVSIYNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDP
                    *..   *  : * *****:*****************************************

    COL             EPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLT
    N315            EPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLT
    NCTC8325        EPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLT
    Newman          EPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLT
    USA300_FPR3757  EPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLT
                    ************************************************************

    COL             LPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLS
    N315            LPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLS
    NCTC8325        LPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLS
    Newman          LPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLS
    USA300_FPR3757  LPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLS
                    ************************************************************

    COL             EQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKK
    N315            EQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKK
    NCTC8325        EQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKK
    Newman          EQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKK
    USA300_FPR3757  EQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKK
                    ************************************************************

    COL             TIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNV
    N315            TIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNANNVTTRNDPDGRSRLNVNV
    NCTC8325        TIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNV
    Newman          TIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNV
    USA300_FPR3757  TIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNV
                    *****************************************:******************

    COL             FTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNM
    N315            FTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNM
    NCTC8325        FTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNM
    Newman          FTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNM
    USA300_FPR3757  FTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNM
                    ************************************************************

    COL             YYPNMDFKDNERHMHKQPQIIQF
    N315            YYPNMDFKDNERHMHKQPQIIQF
    NCTC8325        YYPNMDFKDNERHMHKQPQIIQF
    Newman          YYPNMDFKDNERHMHKQPQIIQF
    USA300_FPR3757  YYPNMDFKDNERHMHKQPQIIQF
                    ***********************