From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1697 [new locus tag: SA_RS09740 ]
  • pan locus tag?: SAUPAN004896000
  • symbol: SA1697
  • pan gene symbol?: ptpA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1697 [new locus tag: SA_RS09740 ]
  • symbol: SA1697
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1944388..1944852
  • length: 465
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGTAGATGTAGCATTTGTCTGTCTTGGCAATATATGTCGTTCTCCAATGGCAGAAGCA
    ATCATGCGACAAAGACTTAAAGACAGAAATATTCATGATATTAAAGTACATTCAAGAGGT
    ACTGGTAGCTGGAATTTAGGAGAGCCGCCTCATGAAGGTACACAAAAAATTCTCAACAAA
    CACAATATTCCATTTGATGGCATGATTAGTGAATTATTCGAAGCGACAGATGATTTTGAT
    TACATTGTGGCTATGGATCAAAGTAACGTTGATAATATTAAATCTATCAATCCTAATCTT
    AAGGGACAATTGTTCAAACTGTTAGAATTTAGTAATATGGAAGAGAGTGATGTACCAGAT
    CCATACTACACGAATAATTTTGAAGGTGTATACGACATGGTATTATCATCTTGTGATAAT
    TTAATAGACTACATCGTAAAAGATGCAAATTTGAAAGAGGGGTAG
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1697 [new locus tag: SA_RS09740 ]
  • symbol: SA1697
  • description: hypothetical protein
  • length: 154
  • theoretical pI: 4.40403
  • theoretical MW: 17490.7
  • GRAVY: -0.396753

Function[edit source | edit]

  • reaction:
    EC 3.1.3.48?  ExPASy
    Protein-tyrosine-phosphataseProtein tyrosine phosphate + H2O = protein tyrosine + phosphate
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationarsenate reductase (thioredoxin) (TIGR02691; EC 1.20.4.-,3.1.3.48; HMM-score: 21.3)
    Cellular processesCellular processesDetoxificationarsenate reductase, glutathione/glutaredoxin type (TIGR02689; EC 1.20.4.1; HMM-score: 14.8)
  • TheSEED:  
    CBSS-176280.1.peg.1561 FIG133424: Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) 
  • PFAM:
    Phosphatase (CL0031) LMWPc; Low molecular weight phosphotyrosine protein phosphatase (PF01451; HMM-score: 123)
    no clan definedWSN; Domain of unknown function (PF02206; HMM-score: 16.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.251
    • Ymax_pos: 21
    • Cmax: 0.243
    • Cmax_pos: 21
    • Smax: 0.353
    • Smax_pos: 17
    • Smean: 0.233
    • D: 0.244
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]