From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1909 [new locus tag: SA_RS10985 ]
  • pan locus tag?: SAUPAN005398000
  • symbol: atpF
  • pan gene symbol?: atpF
  • synonym:
  • product: ATP synthase F0F1 subunit B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1909 [new locus tag: SA_RS10985 ]
  • symbol: atpF
  • product: ATP synthase F0F1 subunit B
  • replicon: chromosome
  • strand: -
  • coordinates: 2159999..2160520
  • length: 522
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGACTGAAACAGCTAACTTATTCGTTCTTGGTGCAGCTGGAGGCGTTGAGTGGGGTACT
    GTGATTGTACAGGTCCTAACTTTCATCGTGTTACTTGCGTTACTTAAAAAGTTCGCATGG
    GGTCCATTGAAAGATGTAATGGATAAACGTGAAAGAGATATTAACAGAGATATCGATGAC
    GCAGAACAAGCTAAGTTAAATGCACAGAAACTTGAAGAAGAAAATAAACAAAAACTTAAA
    GAAACACAAGAAGAAGTTCAAAAGATTTTAGAAGATGCTAAGGTTCAAGCACGTCAACAG
    CAAGAACAAATTATTCATGAAGCAAACGTACGTGCAAACGGTATGATTGAAACAGCACAA
    AGTGAAATCAATAGCCAAAAAGAACGTGCCATTGCAGATATTAATAATCAAGTATCTGAA
    CTATCAGTGTTAATTGCTTCTAAAGTTCTTAGAAAAGAAATTTCTGAACAAGACCAAAAA
    GCATTGGTTGACAAGTATCTAAAAGAGGCAGGCGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    522

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1909 [new locus tag: SA_RS10985 ]
  • symbol: AtpF
  • description: ATP synthase F0F1 subunit B
  • length: 173
  • theoretical pI: 4.75697
  • theoretical MW: 19539.1
  • GRAVY: -0.514451

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 124.4)
    alternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 76)
    hydroxylamine oxidation protein HaoB (TIGR04392; HMM-score: 13.5)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 12.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 7.3)
    two transmembrane protein (TIGR04527; HMM-score: 7)
    alternate F1F0 ATPase, F1 subunit alpha (TIGR03324; EC 3.6.3.-; HMM-score: 6.2)
    MetabolismTransport and binding proteinsCations and iron carrying compoundssodium/hydrogen antiporter (TIGR00844; HMM-score: 4.8)
  • TheSEED:  
    F0F1-type ATP synthase ATP synthase F0 sector subunit b (EC 3.6.3.14) 
  • PFAM:
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 112.3)
    Mt_ATP-synt_B; Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405; HMM-score: 22.1)
    no clan definedLMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 16.8)
    DivIVA; DivIVA protein (PF05103; HMM-score: 14.3)
    Monooxygenase_B; Monooxygenase subunit B protein (PF04744; HMM-score: 11.3)
    HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 11.1)
    RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 10.8)
    YfcL; YfcL protein (PF08891; HMM-score: 9.8)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 7.1)
    CPA_AT (CL0064) Mem_trans; Membrane transport protein (PF03547; HMM-score: 5.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 40
    • Cmax: 0.147
    • Cmax_pos: 26
    • Smax: 0.429
    • Smax_pos: 38
    • Smean: 0.092
    • D: 0.122
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol. Microbiol.: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] (P p)

Relevant publications[edit source | edit]