From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2178 [new locus tag: SA_RS12500 ]
  • pan locus tag?: SAUPAN005920000
  • symbol: SA2178
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2178 [new locus tag: SA_RS12500 ]
  • symbol: SA2178
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2446722..2447462
  • length: 741
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    TTGGCATACACATACACTTTAAAAGATATTATTGAAATTACAGGTGTAACTAAAAGAACT
    TTACATTATTACGATGAAATAGGATTATTAGTTCCAGATAAAAATGATAAAAATTATCGC
    GTTTATAAACAGCAAGACTTAGAAAAATTACAAAAGATTTTAATACTCAAGTCTTTTGAT
    TTTGATATCGCTAAAATAAAACAATACATTTCGTATGATAATGAACAATTGCGAAAGTTA
    TTATCAGAGCAAATAAGCAAGTTAGATAAAAAGATTTCTGACTTACAATTAATTAGACGC
    TCTGTATGTGAATTTATTAAAGGACTCTCTCTAATAGATACCAGCATTTTAAACAAGACA
    CTACAGTCACAATATGATAAAGAAGCATCTATAAAATATGGTCATACGAAAGCATATCAA
    TCATTTATTAGACGTAAAGACAGCTTACAATCGCAGGATATCAGACATAAATTGACAACT
    ATCTTCAATAAATTTAATCATATGTCTTTGAGTCATTATCCAATCCAAGATTGTAGTGAT
    CTCGTATTTGAGTGGAAGGCATTTATGAACACTATCGCTGATTTTGATGATGAAACATTA
    TGCTGTATTGCTAAAACATATGAAGATGATACGCGTTTCAAAGATTACTTTAATTCATAT
    GATAATCAAAATTTAGCATCATACATTTCAGAAGCTGTTAATTATTTTTTGAGCAATGTG
    AATAAGAGCGACAATTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2178 [new locus tag: SA_RS12500 ]
  • symbol: SA2178
  • description: hypothetical protein
  • length: 246
  • theoretical pI: 7.48621
  • theoretical MW: 29126.9
  • GRAVY: -0.555285

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 44.6)
    Signal transductionRegulatory functionsDNA interactionsCd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 40.5)
    Cellular processesCellular processesDetoxificationHg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 39.6)
    Signal transductionRegulatory functionsDNA interactionsHg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 39.6)
    Signal transductionRegulatory functionsDNA interactionsZn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 36.7)
    Cellular processesCellular processesDetoxificationredox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 21.3)
    Signal transductionRegulatory functionsDNA interactionsredox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 21.3)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsCobalt-zinc-cadmium resistance Transcriptional regulator, MerR family 
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 60.7)
    no clan definedTipAS; TipAS antibiotic-recognition domain (PF07739; HMM-score: 53.8)
    HTH (CL0123) MerR; MerR family regulatory protein (PF00376; HMM-score: 42.3)
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 23.1)
    no clan definedMKT1_N; Temperature dependent protein affecting M2 dsRNA replication (PF12247; HMM-score: 14.6)
    Ribosomal_L12_N; Ribosomal protein L7/L12 dimerisation domain (PF16320; HMM-score: 12.5)
    FliD_N; Flagellar hook-associated protein 2 N-terminus (PF02465; HMM-score: 12.5)
    HTH (CL0123) MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 39
    • Cmax: 0.106
    • Cmax_pos: 39
    • Smax: 0.103
    • Smax_pos: 35
    • Smean: 0.075
    • D: 0.087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFDFDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKTLQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSDLVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNVNKSDNF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]