From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2265 [new locus tag: SA_RS13005 ]
  • pan locus tag?: SAUPAN006049000
  • symbol: SA2265
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2265 [new locus tag: SA_RS13005 ]
  • symbol: SA2265
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2542398..2542910
  • length: 513
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTTAGTGTTATGGTTTATAATCTATAATGTTCGTAATTACAGATTACAAAAAAATTTC
    ATTTTCCACCACATTTTAGGAGTTACTTTAATGAACAAAAAACATGTTTTTATAATTATT
    GGTGTCATTTTATGTATATGTATAGTTGCATCAGTCATTTATTTAAAAGTGAAATATGAC
    GAAAAAGAAAAACAAAAAGCAATATACTATAAAGAACAACAGGAGCGTATTACACTCTAT
    CTTAATCATAATACTAAAGAACCCAATACCATCAAAACTGTACATTTCACAAGTTTAAAA
    AGAGGACCTATGGGCGATGCAGTAATTGAAGGTTACATAAATGAAAATAAAGAAGATGAT
    TTTGTTGCATATGGGTCTCCAGAACATAATTATCAATTTGGTGGAAGTTTAATCAAAAGT
    AAAAATTTAAGCACGTTATTAAAACCAGTACATCAAACCAAATCACCTGATGAGATAAAA
    AAGGAATTAGAGTCTAAAAAGAACGACCGCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    513

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2265 [new locus tag: SA_RS13005 ]
  • symbol: SA2265
  • description: hypothetical protein
  • length: 170
  • theoretical pI: 9.78942
  • theoretical MW: 19932.1
  • GRAVY: -0.376471

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 17.6)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 13.5)
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein B (TIGR02976; HMM-score: 12.9)
  • TheSEED:  
    FIG01108221: hypothetical protein 
  • PFAM:
    no clan definedDUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 131.3)
    Viral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 16.5)
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 15.9)
    no clan definedSec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 12.7)
    DUF4500; Domain of unknown function (DUF4500) (PF14937; HMM-score: 12.3)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 11.7)
    PMP1_2; ATPase proteolipid family (PF08114; HMM-score: 6.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.175
    • Ymax_pos: 60
    • Cmax: 0.241
    • Cmax_pos: 60
    • Smax: 0.173
    • Smax_pos: 50
    • Smean: 0.088
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLVLWFIIYNVRNYRLQKNFIFHHILGVTLMNKKHVFIIIGVILCICIVASVIYLKVKYDEKEKQKAIYYKEQQERITLYLNHNTKEPNTIKTVHFTSLKRGPMGDAVIEGYINENKEDDFVAYGSPEHNYQFGGSLIKSKNLSTLLKPVHQTKSPDEIKKELESKKNDR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]