From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • pan locus tag?: SAUPAN006265000
  • symbol: SA2372
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • symbol: SA2372
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2661987..2662355
  • length: 369
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAATAAACTTGATGGAATCAATAAAATGATCACAGCGAAACATAAGCAAATGGAT
    GACTTATATGATGAAAAGCGAGAGGTTAAAGCTTTGATAGACGAAAGTGATGAGCTTAAT
    CATTCGATAGAACAATTATATCAACATTTAGGTGACCGTTATCATAGTAGCAATATGGCT
    AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
    TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGCGGAAGAAGAGATGATT
    GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
    AAACAATAG
    60
    120
    180
    240
    300
    360
    369

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • symbol: SA2372
  • description: hypothetical protein
  • length: 122
  • theoretical pI: 5.61182
  • theoretical MW: 14771.4
  • GRAVY: -1.26066

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    conserved hypothetical protein (TIGR02231; HMM-score: 11.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespolysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.1)
  • TheSEED:  
    FIG01108396: hypothetical protein 
  • PFAM:
    no clan definedFliD_N; Flagellar hook-associated protein 2 N-terminus (PF02465; HMM-score: 13.3)
    Cnl2_NKP2; Cnl2/NKP2 family protein (PF09447; HMM-score: 11.5)
    tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 11)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 9)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 11
    • Cmax: 0.102
    • Cmax_pos: 15
    • Smax: 0.167
    • Smax_pos: 3
    • Smean: 0.098
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNKLDGINKMITAKHKQMDDLYDEKREVKALIDESDELNHSIEQLYQHLGDRYHSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTKEENKWKQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]