From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
  • pan locus tag?: SAUPAN006265000
  • symbol: SACOL2602
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
  • symbol: SACOL2602
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2662462..2662830
  • length: 369
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATGAGCAAATGGAT
    GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
    CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
    AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
    TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGTGGAAGAAGAGATGATT
    GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
    AAACAATAG
    60
    120
    180
    240
    300
    360
    369

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
  • symbol: SACOL2602
  • description: hypothetical protein
  • length: 122
  • theoretical pI: 4.93014
  • theoretical MW: 14822.4
  • GRAVY: -1.18279

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    conserved hypothetical protein (TIGR02231; HMM-score: 12.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespolysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.9)
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein C (TIGR02978; HMM-score: 7.7)
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 5.2)
  • TheSEED:  
    hypothetical protein 
  • PFAM:
    FAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 15.4)
    T3SS-Chaperone (CL0419) YscO-like; YscO-like protein (PF16789; HMM-score: 13.7)
    no clan definedCnl2_NKP2; Cnl2/NKP2 family protein (PF09447; HMM-score: 10.7)
    BCLiA (CL0551) Atg14; Vacuolar sorting 38 and autophagy-related subunit 14 (PF10186; HMM-score: 8)
    no clan definedLMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.096
    • Ymax_pos: 70
    • Cmax: 0.106
    • Cmax_pos: 20
    • Smax: 0.113
    • Smax_pos: 69
    • Smean: 0.072
    • D: 0.087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKWKQ

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [1]
    quantitative data / protein copy number per cell: 62 [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]