From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2461 [new locus tag: SA_RS14090 ]
  • pan locus tag?: SAUPAN006413000
  • symbol: icaB
  • pan gene symbol?: icaB
  • synonym:
  • product: intercellular adhesion protein B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2461 [new locus tag: SA_RS14090 ]
  • symbol: icaB
  • product: intercellular adhesion protein B
  • replicon: chromosome
  • strand: +
  • coordinates: 2772001..2772873
  • length: 873
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGAAGTATAGAAAATTAATAATTTTAGTGTTGAGTATCTTGATCATATTGCCTGTAAGC
    ACACTGGATGGTCATCATATTGCAAATGCAGATGACGATTCACCTAAAAAACTGAAATAT
    AAAGAAAATAGTGCTCTGGCATTAAATTATCACCGTGTAAGAAAAGCGAATTTTCTGAAT
    AATTTTATTTACTTCTTTTCTAGTAGTAAAGAAATTAAAAATTATAGTGTTAGTCAATCA
    CAATTTGAATCTCAAATAAAATGGCTAAAATCACATGATGCTAAATTTTTAACCTTGAAA
    GAATTTTTATATTACAAGAAAAAAGGTAAGTTTCCAAAACGAAGTGTATGGATTAACTTT
    GATGATATGGATGAAACTATTTATGAAAATGCTTATCCAATCTTAAAAAAATATAAAATA
    CCGGCAACTGGGTTTATTATCACAGGTCATGTTGGGGAAGAAAACTTTCACAACCTCGAT
    ATGATTAGTAAAAAAGAACTAAAAGAAATGTATAAAACTGGGTTATGGGAATTTGAAACA
    CATACCCACGATTTGCATAACTTATCTAAAAATAATAAGTCAAAATTAATGAAAGCTTCT
    GAAGCTACAATCATAAAAGATTTAAACAAAAGTGAAAAATATCTAACTAAAAACTTTAAA
    AAGTCGCAGAAAACTATAGCCTATCCTTATGGCTTGATGAATGACGATAAATTACCGGTA
    ATCAAAAAAGCTGGGTTAAAATACGGTTTTTCATTAGAGGAAAAAGCAGTCACTCCGAAC
    TCCAATGATTATTACATCCCTAGAATATTAATTAGTGATGATGCTTTTGAGCATTTAATT
    AAGAGATGGGACGGATTCCATGAAAAAGATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    873

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2461 [new locus tag: SA_RS14090 ]
  • symbol: IcaB
  • description: intercellular adhesion protein B
  • length: 290
  • theoretical pI: 9.93319
  • theoretical MW: 34071.1
  • GRAVY: -0.597586

Function[edit source | edit]

  • reaction:
    EC 3.5.1.-?  ExPASy
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.7)
    Cellular processesCellular processesPathogenesisintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.7)
    and 3 more
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespoly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB (TIGR03938; EC 3.5.1.-; HMM-score: 110.6)
    Cellular processesCellular processesSporulation and germinationpolysaccharide deacetylase family sporulation protein PdaB (TIGR02764; HMM-score: 26.4)
    chitooligosaccharide deacetylase NodB (TIGR04243; EC 3.5.1.-; HMM-score: 17.1)
  • TheSEED:  
    Regulation and Cell signalingQuorum sensing and biofilm formationBiofilm formation in Staphylococcus Polysaccharide intercellular adhesin (PIA) biosynthesis deacetylase IcaB (EC 3.-.-.-) 
  • PFAM:
    GH_CE (CL0158) Polysacc_deac_1; Polysaccharide deacetylase (PF01522; HMM-score: 105.1)
    and 1 more
    no clan definedPRESAN; Plasmodium RESA N-terminal (PF09687; HMM-score: 17.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.547
    • Ymax_pos: 31
    • Cmax: 0.415
    • Cmax_pos: 31
    • Smax: 0.928
    • Smax_pos: 21
    • Smean: 0.737
    • D: 0.621
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKYRKLIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: CodY (repression) regulon, IcaR (repression) regulon
    CodY(TF)important in Amino acid metabolismRegPrecise
    IcaR(TF)important in Intercellular adhesionRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Ursula Fluckiger, Martina Ulrich, Andrea Steinhuber, Gerd Döring, Dietrich Mack, Regine Landmann, Christiane Goerke, Christiane Wolz
Biofilm formation, icaADBC transcription, and polysaccharide intercellular adhesin synthesis by staphylococci in a device-related infection model.
Infect. Immun.: 2005, 73(3);1811-9
[PubMed:15731082] [WorldCat.org] [DOI] (P p)
C Heilmann, O Schweitzer, C Gerke, N Vanittanakom, D Mack, F Götz
Molecular basis of intercellular adhesion in the biofilm-forming Staphylococcus epidermidis.
Mol. Microbiol.: 1996, 20(5);1083-91
[PubMed:8809760] [WorldCat.org] (P p)