From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006413000
  • symbol?: icaB
  • description?: intercellular adhesion protein B

      descriptions from strain specific annotations:

    • intercellular adhesion protein B
    • poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
    • Polysaccharide intercellular adhesin (PIA) biosynthesis deacetylase IcaB
    • biofilm PIA synthesis deacetylase IcaB (Intercellular adhesion protein B)
    • intercellular adhesin biosynthesis polysaccharide N-deacetylase
    • intercellular adhesion deacetylase IcaB
    • polysaccharide deacetylase family protein
  • strand?: +
  • coordinates?: 6462930..6463823
  • synteny block?: BlockID0051200
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2691 (icaB)
    N315:
    SA2461 (icaB)
    NCTC8325:
    Newman:
    NWMN_2567 (icaB)
    USA300_FPR3757:
    04-02981:
    SA2981_2607 (icaB)
    08BA02176:
    C248_2737 (icaB)
    11819-97:
    MS7_2673 (icaB)
    71193:
    ST398NM01_2719
    ECT-R 2:
    ECTR2_2521
    ED133:
    ED98:
    SAAV_2740 (icaB)
    HO 5096 0412:
    SAEMRSA15_25750 (icaB)
    JH1:
    SaurJH1_2749
    JH9:
    SaurJH9_2692
    JKD6008:
    SAA6008_02727 (icaB)
    JKD6159:
    SAA6159_02564 (icaB)
    LGA251:
    SARLGA251_24420 (icaB)
    M013:
    M013TW_2651
    MRSA252:
    SAR2749 (icaB)
    MSHR1132:
    SAMSHR1132_24960
    MSSA476:
    SAS2554
    Mu3:
    SAHV_2652 (icaB)
    Mu50:
    SAV2668 (icaB)
    MW2:
    MW2588 (icaB)
    RF122:
    SAB2543 (icaB)
    ST398:
    SAPIG2719
    T0131:
    SAT0131_02946 (vraE)
    TCH60:
    HMPREF0772_10518 (icaB)
    TW20:
    SATW20_28060 (icaB)
    USA300_TCH1516:
    USA300HOU_2668 (icaB)
    VC40:
    SAVC_12220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLN
    N315            MKYRKLIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLN
    NCTC8325        MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLN
    Newman          MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLN
    USA300_FPR3757  MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLN
                    *****:******************************************************

    COL             NFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINF
    N315            NFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINF
    NCTC8325        NFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINF
    Newman          NFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINF
    USA300_FPR3757  NFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINF
                    ************************************************************

    COL             DDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFET
    N315            DDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFET
    NCTC8325        DDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFET
    Newman          DDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFET
    USA300_FPR3757  DDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFET
                    ************************************************************

    COL             HTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPV
    N315            HTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPV
    NCTC8325        HTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPV
    Newman          HTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPV
    USA300_FPR3757  HTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPV
                    ************************************************************

    COL             IKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKDET
    N315            IKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD--
    NCTC8325        IKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD--
    Newman          IKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD--
    USA300_FPR3757  IKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD--
                    **************************************************