From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2464 [new locus tag: SA_RS14110 ]
  • pan locus tag?: SAUPAN006427000
  • symbol: hisI
  • pan gene symbol?: hisI
  • synonym:
  • product: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2464 [new locus tag: SA_RS14110 ]
  • symbol: hisI
  • product: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  • replicon: chromosome
  • strand: -
  • coordinates: 2777382..2778014
  • length: 633
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACCAAATATAAAATTGATTTTAGCAAAGGTTTAGTGCCAGCAATTTTACAAGATAAT
    CAAACAAAACAAGTATTGATGTTGGGTTATATGAATCAAGAAGCTTTTGATAAAACGATA
    GAAGATGGTGTGGTATGTTTCTATTCGCGGTCGAAACAACGTCTATGGACAAAAGGTGAA
    ACATCTGGTCATACGCAACTTGTTAAAGATATTCATGTAGATTGCGACAATGATACTATT
    TTAATTGATGTCATACCAAATGGACCAACATGTCATACAGGCAGTCAAAGTTGTTTCAAC
    ACAGAAGTTCCATTTTCAGTGCAAACATTAGCGCAGACAGTTCAAGATAGTGCCCAATCC
    AATAATGAAAAGTCATATACAAAATATTTATTAACAGAAGGTATAGAAAAGATTACAAAA
    AAATACGGTGAAGAAGCTTTTGAAGTCGTAATTGAAGCAATTAAAGGTGACAAAAAAGCA
    TTTGTAAGTGAAGTAGCAGATGAACTTTATCATTTATTTGTCTTGATGCATGCGCTAGGC
    GTCGATTTTTCAGAAATTGAGGCGGAATTAGCGCGTAGACATCATAAGCGCAATAACTTT
    AAAGGTGAACGACAAAATATCGAACAGTGGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    633

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2464 [new locus tag: SA_RS14110 ]
  • symbol: HisI
  • description: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  • length: 210
  • theoretical pI: 5.6078
  • theoretical MW: 23943.9
  • GRAVY: -0.489048

Function[edit source | edit]

  • reaction:
    EC 3.6.1.31?  ExPASy
    Phosphoribosyl-ATP diphosphatase1-(5-phospho-beta-D-ribosyl)-ATP + H2O = 1-(5-phospho-beta-D-ribosyl)-AMP + diphosphate
    EC 3.5.4.19?  ExPASy
    Phosphoribosyl-AMP cyclohydrolase1-(5-phospho-beta-D-ribosyl)-AMP + H2O = 1-(5-phospho-beta-D-ribosyl)-5-((5-phospho-beta-D-ribosylamino)methylideneamino)imidazole-4-carboxamide
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyphosphoribosyl-ATP diphosphatase (TIGR03188; EC 3.6.1.31; HMM-score: 90.9)
  • TheSEED:  
    Histidine Biosynthesis in plants Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) 
    Histidine Biosynthesis Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) 
  • PFAM:
    no clan definedPRA-CH; Phosphoribosyl-AMP cyclohydrolase (PF01502; HMM-score: 114.7)
    MazG (CL0231) PRA-PH; Phosphoribosyl-ATP pyrophosphohydrolase (PF01503; HMM-score: 51.3)
    MazG-like; MazG-like family (PF12643; HMM-score: 18.7)
    MazG; MazG nucleotide pyrophosphohydrolase domain (PF03819; HMM-score: 15.1)
    Beta_propeller (CL0186) BBS2_Mid; Ciliary BBSome complex subunit 2, middle region (PF14783; HMM-score: 14.7)
    no clan definedMnmE_helical; MnmE helical domain (PF12631; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.153
    • Ymax_pos: 11
    • Cmax: 0.121
    • Cmax_pos: 36
    • Smax: 0.429
    • Smax_pos: 1
    • Smean: 0.185
    • D: 0.165
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKYKIDFSKGLVPAILQDNQTKQVLMLGYMNQEAFDKTIEDGVVCFYSRSKQRLWTKGETSGHTQLVKDIHVDCDNDTILIDVIPNGPTCHTGSQSCFNTEVPFSVQTLAQTVQDSAQSNNEKSYTKYLLTEGIEKITKKYGEEAFEVVIEAIKGDKKAFVSEVADELYHLFVLMHALGVDFSEIEAELARRHHKRNNFKGERQNIEQW

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: SA1723 (HisR*), CodY
    HisR* (TF) important in Histidine biosynthesisRegPrecise
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]