From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0244 [new locus tag: SACOL_RS01235 ]
  • pan locus tag?: SAUPAN001138000
  • symbol: scdA
  • pan gene symbol?: scdA
  • synonym:
  • product: cell wall biosynthesis protein ScdA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0244 [new locus tag: SACOL_RS01235 ]
  • symbol: scdA
  • product: cell wall biosynthesis protein ScdA
  • replicon: chromosome
  • strand: +
  • coordinates: 284503..285177
  • length: 675
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAAATAAAAATGACATAGTAGCAGATGTAGTAACTGATTATCCGAAAGCAGCGGAT
    ATTTTTAGAAGTGTGGGAATAGATTTTTGTTGTGGCGGACAAGTAAGTATAGAAGCAGCA
    GCCTTAGAAAAGAAAAATGTAGATTTGAACGAATTATTACAGCGTCTCAACGACGTTGAA
    CAAACGAATACACCAGGTTCGTTAAATCCTAAATTTTTAAATGTTTCATCACTTATTCAA
    TATATTCAATCAGCATATCATGAACCTCTAAGAGAAGAATTTAAAAATTTAACACCTTAT
    GTGACGAAGTTATCGAAAGTACATGGACCTAATCATCCATATTTAGTTGAGTTAAAAGAA
    ACATACGATACATTTAAAAATGGCATGTTAGAGCATATGCAAAAAGAAGACGATGTCGAT
    TTTCCAAAACTCATTAAATATGAGCAAGGTGAGGTAGTAGACGATATTAATACTGTGATA
    GATGATTTAGTTTCAGACCACATTGCAACGGGAGAATTGTTAGTAAAAATGAGCGAATTA
    ACATCTAGTTATGAACCTCCGATAGAAGCGTGTGGTACTTGGCGACTTGTTTATCAGAGA
    TTAAAAGCACTTGAAGTGTTAACACATGAACACGTACATTTAGAGAATCACGTATTATTT
    AAAAAAGTATCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0244 [new locus tag: SACOL_RS01235 ]
  • symbol: ScdA
  • description: cell wall biosynthesis protein ScdA
  • length: 224
  • theoretical pI: 4.79982
  • theoretical MW: 25484.8
  • GRAVY: -0.326786

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster repair di-iron protein (TIGR03652; HMM-score: 256)
    MetabolismEnergy metabolismElectron transporthybrid cluster protein-associated redox disulfide domain (TIGR03980; HMM-score: 18.1)
    MetabolismFatty acid and phospholipid metabolismBiosynthesispoly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 13.5)
  • TheSEED:  
    Nitrogen MetabolismNitrogen Metabolism - no subcategoryNitrosative stress Nitric oxide-dependent regulator DnrN or NorA 
    Stress ResponseStress Response - no subcategoryFlavohaemoglobin Nitric oxide-dependent regulator DnrN or NorA 
  • PFAM:
    no clan definedScdA_N; Domain of Unknown function (DUF542) (PF04405; HMM-score: 75.4)
    Hemerythrin; Hemerythrin HHE cation binding domain (PF01814; HMM-score: 71.1)
    DUF1858; Domain of unknown function (DUF1858) (PF08984; HMM-score: 23.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.247
    • Ymax_pos: 41
    • Cmax: 0.225
    • Cmax_pos: 41
    • Smax: 0.448
    • Smax_pos: 39
    • Smean: 0.139
    • D: 0.205
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVEQTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKETYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSELTSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2]
    quantitative data / protein copy number per cell: 63 [3]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 14.41 h [4]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  4. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Anthony R Richardson, Paul M Dunman, Ferric C Fang
The nitrosative stress response of Staphylococcus aureus is required for resistance to innate immunity.
Mol. Microbiol.: 2006, 61(4);927-39
[PubMed:16859493] [WorldCat.org] [DOI] (P p)