From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00229
  • pan locus tag?: SAUPAN001138000
  • symbol: SAOUHSC_00229
  • pan gene symbol?: scdA
  • synonym:
  • product: cell wall biosynthesis protein ScdA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00229
  • symbol: SAOUHSC_00229
  • product: cell wall biosynthesis protein ScdA
  • replicon: chromosome
  • strand: +
  • coordinates: 250591..251265
  • length: 675
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAAATAAAAATGACATAGTAGCAGATGTAGTAACTGATTATCCGAAAGCAGCGGAT
    ATTTTTAGAAGTGTGGGAATAGATTTTTGTTGTGGCGGACAAGTAAGTATAGAAGCAGCA
    GCCTTAGAAAAGAAAAATGTAGATTTGAACGAATTATTACAGCGTCTCAACGACGTTGAA
    CAAACGAATACACCAGGTTCGTTAAATCCTAAATTTTTAAATGTTTCATCACTTATTCAA
    TATATTCAATCAGCATATCATGAACCTCTAAGAGAAGAATTTAAAAATTTAACACCTTAT
    GTGACGAAGTTATCGAAAGTACATGGACCTAATCATCCATATTTAGTTGAGTTAAAAGAA
    ACATACGATACATTTAAAAATGGCATGTTAGAGCATATGCAAAAAGAAGACGATGTCGAT
    TTTCCAAAACTCATTAAATATGAGCAAGGTGAGGTAGTAGACGATATTAATACTGTGATA
    GATGATTTAGTTTCAGACCACATTGCAACGGGAGAATTGTTAGTAAAAATGAGCGAATTA
    ACATCTAGTTATGAACCTCCGATAGAAGCGTGTGGTACTTGGCGACTTGTTTATCAGAGA
    TTAAAAGCACTTGAAGTGTTAACACATGAACACGTACATTTAGAGAATCACGTATTATTT
    AAAAAAGTATCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00229
  • symbol: SAOUHSC_00229
  • description: cell wall biosynthesis protein ScdA
  • length: 224
  • theoretical pI: 4.79982
  • theoretical MW: 25484.8
  • GRAVY: -0.326786

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster repair di-iron protein (TIGR03652; HMM-score: 256)
    MetabolismEnergy metabolismElectron transporthybrid cluster protein-associated redox disulfide domain (TIGR03980; HMM-score: 18.1)
    MetabolismFatty acid and phospholipid metabolismBiosynthesispoly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 13.5)
  • TheSEED:  
    Nitrogen MetabolismNitrogen Metabolism - no subcategoryNitrosative stress Nitric oxide-dependent regulator DnrN or NorA 
    Stress ResponseStress Response - no subcategoryFlavohaemoglobin Nitric oxide-dependent regulator DnrN or NorA 
  • PFAM:
    no clan definedScdA_N; Domain of Unknown function (DUF542) (PF04405; HMM-score: 75.4)
    Hemerythrin; Hemerythrin HHE cation binding domain (PF01814; HMM-score: 71.1)
    DUF1858; Domain of unknown function (DUF1858) (PF08984; HMM-score: 23.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.247
    • Ymax_pos: 41
    • Cmax: 0.225
    • Cmax_pos: 41
    • Smax: 0.448
    • Smax_pos: 39
    • Smean: 0.139
    • D: 0.205
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVEQTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKETYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSELTSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Wook Chang, David A Small, Freshteh Toghrol, William E Bentley
Global transcriptome analysis of Staphylococcus aureus response to hydrogen peroxide.
J. Bacteriol.: 2006, 188(4);1648-59
[PubMed:16452450] [WorldCat.org] [DOI] (P p)
Tim W Overton, Marta C Justino, Ying Li, Joana M Baptista, Ana M P Melo, Jeffrey A Cole, Lígia M Saraiva
Widespread distribution in pathogenic bacteria of di-iron proteins that repair oxidative and nitrosative damage to iron-sulfur centers.
J. Bacteriol.: 2008, 190(6);2004-13
[PubMed:18203837] [WorldCat.org] [DOI] (I p)
E W Brunskill, B L de Jonge, K W Bayles
The Staphylococcus aureus scdA gene: a novel locus that affects cell division and morphogenesis.
Microbiology (Reading, Engl.): 1997, 143 ( Pt 9);2877-82
[PubMed:9308171] [WorldCat.org] [DOI] (P p)