From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001138000
  • symbol?: scdA
  • description?: cell wall biosynthesis protein ScdA

      descriptions from strain specific annotations:

    • cell wall biosynthesis protein ScdA
    • Nitric oxide-dependent regulator DnrN or NorA
    • hemerythrin HHE cation binding domain protein
    • iron-sulfur cluster repair di-iron protein
    • cell wall metabolism protein
    • ScdA protein
    • cell division and morphogenesis-related protein
    • Cell wall-related protein scdA
  • strand?: +
  • coordinates?: 1409032..1409739
  • synteny block?: BlockID0006580
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0244 (scdA)
    N315:
    SA0249 (scdA)
    NCTC8325:
    Newman:
    NWMN_0193 (scdA)
    USA300_FPR3757:
    04-02981:
    SA2981_0259 (dnRN)
    08BA02176:
    C248_0247 (scdA)
    11819-97:
    MS7_0249 (ric)
    71193:
    ST398NM01_0272
    ECT-R 2:
    ECTR2_220
    ED133:
    SAOV_0199
    ED98:
    SAAV_0227 (scdA)
    HO 5096 0412:
    SAEMRSA15_02180 (scdA)
    JH1:
    SaurJH1_0250
    JH9:
    SaurJH9_0244
    JKD6008:
    SAA6008_00233 (scdA)
    JKD6159:
    SAA6159_00236 (scdA)
    LGA251:
    SARLGA251_02230 (scdA)
    M013:
    M013TW_0240
    MRSA252:
    SAR0256 (scdA)
    MSHR1132:
    MSSA476:
    SAS0236
    Mu3:
    SAHV_0258 (scdA)
    Mu50:
    SAV0259 (scdA)
    MW2:
    MW0235 (scdA)
    RF122:
    SAB0198 (scdA)
    ST398:
    SAPIG0272
    T0131:
    SAT0131_00252
    TCH60:
    HMPREF0772_10243 (ric)
    TW20:
    SATW20_02610 (scdA)
    USA300_TCH1516:
    USA300HOU_0270 (scdA)
    VC40:
    SAVC_01035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVE
    N315            MINKNDIVADIVIDYPKAADIFRSVGIDFCCGGQVSIEAASLEKKNVDLNELLQRLNDVE
    NCTC8325        MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVE
    Newman          MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVE
    USA300_FPR3757  MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVE
                    **********:* ***************************:*******************

    COL             QTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKE
    N315            QTNTPGSLNPKFLNVSSLIQYIQAAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKE
    NCTC8325        QTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKE
    Newman          QTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKE
    USA300_FPR3757  QTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKE
                    ***********************:************************************

    COL             TYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSEL
    N315            TYDTFKSGMLEHMQKEDDVDFPKLIKYEQGEVVNDINTVIDDLVSDHIATGQLLVKMSDL
    NCTC8325        TYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSEL
    Newman          TYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSEL
    USA300_FPR3757  TYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSEL
                    ******.**************************:*****************:******:*

    COL             TSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS
    N315            TSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS
    NCTC8325        TSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS
    Newman          TSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS
    USA300_FPR3757  TSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS
                    ********************************************