From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0536 [new locus tag: SACOL_RS02740 ]
  • pan locus tag?: SAUPAN002231000
  • symbol: ksgA
  • pan gene symbol?: ksgA
  • synonym:
  • product: dimethyladenosine transferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0536 [new locus tag: SACOL_RS02740 ]
  • symbol: ksgA
  • product: dimethyladenosine transferase
  • replicon: chromosome
  • strand: +
  • coordinates: 545535..546428
  • length: 894
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGTTGGATAATAAAGATATTGCAACACCATCAAGAACGCGAGCGTTGTTAGATAAATAT
    GGCTTTAATTTTAAAAAAAGTTTAGGACAGAACTTTTTGATAGATGTGAATATCATTAAT
    AATATCATTGATGCAAGTGATATTGATGCACAAACTGGGGTGATTGAAATTGGTCCAGGC
    ATGGGGTCATTGACAGAACAATTGGCCAGACATGCTAAAAGAGTATTGGCATTTGAAATT
    GATCAACGTTTAATACCTGTATTAAATGATACACTATCACCTTATGATAATGTGACGGTG
    ATTAATGAAGATATTTTAAAAGCGAATATTAAAGAAGCTGTTGAAAATCATTTACAAGAT
    TGTGAAAAAATAATGGTTGTTGCAAACCTGCCGTACTATATTACGACGCCAATTTTATTA
    AATTTGATGCAACAAGATATACCAATTGATGGCTACGTGGTGATGATGCAAAAAGAAGTG
    GGCGAACGCTTAAATGCTGAAGTAGGTTCAAAAGCATATGGTTCGTTATCAATTGTCGTA
    CAATACTATACAGAGACTAGTAAAGTATTAACGGTACCTAAATCTGTATTTATGCCACCA
    CCTAATGTTGATTCAATAGTTGTAAAACTGATGCAGAGAACTGAACCGTTAGTAACAGTA
    GATAACGAGGAAGCATTCTTTAAGTTAGCAAAAGCAGCATTTGCACAAAGAAGAAAGACA
    ATTAACAATAACTATCAAAATTATTTTAAAGATGGTAAACAACACAAAGAAGTGATTTTA
    CAATGGTTGGAACAAGCAGGTATTGATCCAAGACGTCGCGGTGAAACGCTATCTATTCAA
    GATTTTGCTAAATTGTATGAAGAAAAGAAAAAATTCCCTCAATTAGAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    894

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0536 [new locus tag: SACOL_RS02740 ]
  • symbol: KsgA
  • description: dimethyladenosine transferase
  • length: 297
  • theoretical pI: 5.49072
  • theoretical MW: 33737.6
  • GRAVY: -0.280471

Function[edit source | edit]

  • reaction:
    EC 2.1.1.182?  ExPASy
    16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase4 S-adenosyl-L-methionine + adenine1518/adenine1519 in 16S rRNA = 4 S-adenosyl-L-homocysteine + N6-dimethyladenine1518/N6-dimethyladenine1519 in 16S rRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 281.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 18.2)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 15.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 13.4)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 12.7)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182) 
  • PFAM:
    NADP_Rossmann (CL0063) RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 235.4)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 20.8)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 19.1)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 17.8)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 16.4)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 16)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 14.6)
    RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 51
    • Cmax: 0.162
    • Cmax_pos: 51
    • Smax: 0.22
    • Smax_pos: 1
    • Smean: 0.122
    • D: 0.136
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPGMGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQDCEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVVQYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKTINNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 83 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 19.62 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]