From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002231000
  • symbol?: ksgA
  • description?: dimethyladenosine transferase

      descriptions from strain specific annotations:

    • dimethyladenosine transferase
    • ribosomal RNA adenine dimethylase
    • KsgA/Dim1 family 16S ribosomal RNA methyltransferase
    • ribosomal RNA small subunit methyltransferase A
  • strand?: +
  • coordinates?: 2739870..2740781
  • synteny block?: BlockID0015300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0536 (ksgA)
    N315:
    SA0451 (ksgA)
    NCTC8325:
    Newman:
    NWMN_0456 (ksgA)
    USA300_FPR3757:
    04-02981:
    SA2981_0468
    08BA02176:
    C248_0548
    11819-97:
    MS7_0470 (ksgA)
    71193:
    ST398NM01_0559
    ECT-R 2:
    ECTR2_433 (ksgA)
    ED133:
    SAOV_0515 (ksgA)
    ED98:
    SAAV_0440 (ksgA)
    HO 5096 0412:
    SAEMRSA15_04190
    JH1:
    SaurJH1_0527 (ksgA)
    JH9:
    SaurJH9_0514 (ksgA)
    JKD6008:
    SAA6008_00497 (ksgA)
    JKD6159:
    SAA6159_00444 (ksgA)
    LGA251:
    SARLGA251_04270
    M013:
    M013TW_0464
    MRSA252:
    SAR0494 (ksgA)
    MSHR1132:
    SAMSHR1132_04370
    MSSA476:
    SAS0450 (ksgA)
    Mu3:
    SAHV_0490 (ksgA)
    Mu50:
    SAV0493 (ksgA)
    MW2:
    MW0448 (ksgA)
    RF122:
    SAB0442 (ksgA)
    ST398:
    SAPIG0559 (ksgA)
    T0131:
    SAT0131_00538
    TCH60:
    HMPREF0772_10027 (ksgA)
    TW20:
    SATW20_05610
    USA300_TCH1516:
    USA300HOU_0493 (ksgA)
    VC40:
    SAVC_02050 (ksgA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPG
    N315            MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPG
    NCTC8325        MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPG
    Newman          MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPG
    USA300_FPR3757  MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDASDIDAQTGVIEIGPG
                    ************************************************************

    COL             MGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQD
    N315            MGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQD
    NCTC8325        MGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQD
    Newman          IGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQD
    USA300_FPR3757  MGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINEDILKANIKEAVENHLQD
                    :***********************************************************

    COL             CEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVV
    N315            CEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVV
    NCTC8325        CEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVV
    Newman          CEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVV
    USA300_FPR3757  CEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGERLNAEVGSKAYGSLSIVV
                    ************************************************************

    COL             QYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKT
    N315            QYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKT
    NCTC8325        QYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKT
    Newman          QYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKT
    USA300_FPR3757  QYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDNEEAFFKLAKAAFAQRRKT
                    ************************************************************

    COL             INNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN
    N315            INNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN
    NCTC8325        INNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN
    Newman          INNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN
    USA300_FPR3757  INNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQDFAKLYEEKKKFPQLEN
                    *********************************************************