From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1054 [new locus tag: SACOL_RS05375 ]
  • pan locus tag?: SAUPAN003248000
  • symbol: menB
  • pan gene symbol?: menB
  • synonym:
  • product: naphthoate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1054 [new locus tag: SACOL_RS05375 ]
  • symbol: menB
  • product: naphthoate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1060326..1061147
  • length: 822
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACTAACAGACAATGGGAAACACTTAGAGAATATGATGAAATCAAATATGAATTTTAC
    GAAGGGATTGCTAAGGTAACAATAAATCGCCCTGAAGTACGCAATGCGTTTACACCTAAA
    ACAGTTGCTGAAATGATTGACGCATTTTCACGTGCACGTGATGATCAAAACGTTTCAGTT
    ATCGTATTAACTGGTGAAGGTGATTTAGCATTCTGTTCTGGTGGTGACCAGAAGAAACGT
    GGACATGGTGGTTATGTAGGTGAAGACCAAATCCCTCGCTTAAATGTATTAGATTTACAG
    CGTTTAATTCGTATTATTCCAAAACCGGTTATCGCGATGGTAAAAGGTTATGCTGTAGGT
    GGCGGTAATGTACTAAATGTTGTTTGTGACTTAACGATTGCTGCTGATAATGCTATTTTT
    GGACAAACTGGTCCTAAAGTAGGTTCATTTGATGCGGGTTATGGTTCAGGATATTTAGCA
    CGTATCGTTGGACATAAGAAAGCACGTGAAATTTGGTACTTATGTCGTCAATACAATGCA
    CAAGAAGCTTTAGATATGGGTCTAGTAAATACAGTGGTACCTTTAGAGAAAGTTGAAGAT
    GAAACTGTGCAATGGTGTAAAGAGATTATGAAACACTCACCAACAGCGTTACGATTCCTT
    AAAGCAGCTATGAATGCTGACACAGATGGTTTAGCTGGTTTACAACAAATGGCTGGGGAT
    GCAACATTGCTTTATTACACAACTGATGAAGCGAAAGAAGGCCGTGATGCGTTTAAAGAA
    AAACGTGATCCTGACTTCGATCAATTCCCTAAATTCCCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit source | edit]

Protein Data Bank: 2UZF

General[edit source | edit]

  • locus tag: SACOL1054 [new locus tag: SACOL_RS05375 ]
  • symbol: MenB
  • description: naphthoate synthase
  • length: 273
  • theoretical pI: 5.23939
  • theoretical MW: 30425.4
  • GRAVY: -0.358608

Function[edit source | edit]

  • reaction:
    EC 4.1.3.36?  ExPASy
    1,4-dihydroxy-2-naphthoyl-CoA synthase4-(2-carboxyphenyl)-4-oxobutanoyl-CoA = 1,4-dihydroxy-2-naphthoyl-CoA + H2O
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonenaphthoate synthase (TIGR01929; EC 4.1.3.36; HMM-score: 424.3)
    2-ketocyclohexanecarboxyl-CoA hydrolase (TIGR03210; EC 3.7.-.-; HMM-score: 315.5)
    phenylacetate degradation probable enoyl-CoA hydratase PaaB (TIGR02280; EC 4.2.1.17; HMM-score: 118.4)
    6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase (TIGR03200; EC 3.-.-.-; HMM-score: 101.6)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty oxidation complex, alpha subunit FadB (TIGR02437; EC 1.1.1.35,4.2.1.17,5.1.2.3,5.3.3.8; HMM-score: 56.8)
    cyclohexa-1,5-dienecarbonyl-CoA hydratase (TIGR03189; EC 4.2.1.100; HMM-score: 54.2)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty oxidation complex, alpha subunit FadJ (TIGR02440; EC 1.1.1.35,4.2.1.17,5.1.2.3; HMM-score: 48.2)
    fatty acid oxidation complex, alpha subunit, mitochondrial (TIGR02441; EC 1.1.1.35,4.2.1.17; HMM-score: 36.6)
    benzoyl-CoA-dihydrodiol lyase (TIGR03222; EC 4.1.2.44; HMM-score: 21.1)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidessignal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 13.5)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsQuinone cofactorsMenaquinone and Phylloquinone Biosynthesis Naphthoate synthase (EC 4.1.3.36) 
    Quinone cofactorsMenaquinone biosynthesis from chorismate via 1,4-dihydroxy-2-naphthoate Naphthoate synthase (EC 4.1.3.36) 
  • PFAM:
    ClpP_crotonase (CL0127) ECH_1; Enoyl-CoA hydratase/isomerase (PF00378; HMM-score: 298.6)
    ECH_2; Enoyl-CoA hydratase/isomerase (PF16113; HMM-score: 76.4)
    NTF2 (CL0051) SnoaL_3; SnoaL-like domain (PF13474; HMM-score: 13.6)
    ClpP_crotonase (CL0127) Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 13.2)
    no clan definedDUF1666; Protein of unknown function (DUF1666) (PF07891; HMM-score: 12.7)
    ClpP_crotonase (CL0127) SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: bicarbonate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 37
    • Cmax: 0.154
    • Cmax_pos: 37
    • Smax: 0.122
    • Smax_pos: 12
    • Smean: 0.079
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNRQWETLREYDEIKYEFYEGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDFDQFPKFP

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3] [4]
    quantitative data / protein copy number per cell: 1004 [5]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Venkatasubramanian Ulaganathan, Mark F Agacan, Lori Buetow, Lindsay B Tulloch, William N Hunter
Structure of Staphylococcus aureus1,4-dihydroxy-2-naphthoyl-CoA synthase (MenB) in complex with acetoacetyl-CoA.
Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun.: 2007, 63(Pt 11);908-13
[PubMed:18007038] [WorldCat.org] [DOI] (I p)
Ming Jiang, Minjiao Chen, Zu-Feng Guo, Zhihong Guo
A bicarbonate cofactor modulates 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase in menaquinone biosynthesis of Escherichia coli.
J. Biol. Chem.: 2010, 285(39);30159-69
[PubMed:20643650] [WorldCat.org] [DOI] (I p)