From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0898 [new locus tag: SA_RS05095 ]
  • pan locus tag?: SAUPAN003248000
  • symbol: menB
  • pan gene symbol?: menB
  • synonym:
  • product: naphthoate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0898 [new locus tag: SA_RS05095 ]
  • symbol: menB
  • product: naphthoate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1018958..1019779
  • length: 822
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACTAACAGACAATGGGAAACACTTAGAGAATATGATGAAATCAAATATGAATTTTAC
    GAAGGGATTGCTAAGGTAACAATAAATCGCCCTGAAGTACGCAATGCGTTTACACCTAAA
    ACAGTTGCTGAAATGATTGACGCATTTTCACGTGCACGTGATGATCAAAACGTTTCAGTT
    ATCGTATTAACTGGTGAAGGTGATTTAGCATTCTGTTCTGGTGGTGACCAGAAGAAACGT
    GGACATGGTGGTTATGTAGGTGAAGACCAAATCCCTCGCTTAAATGTATTAGATTTACAG
    CGTTTAATTCGTATTATTCCAAAACCGGTTATCGCGATGGTAAAAGGTTATGCTGTAGGT
    GGCGGTAATGTACTAAATGTTGTTTGTGACTTAACGATTGCTGCTGATAATGCTATTTTT
    GGACAAACTGGTCCTAAAGTAGGTTCATTTGATGCAGGTTATGGTTCAGGATATTTAGCA
    CGTATCGTTGGACATAAGAAAGCACGTGAAATCTGGTACTTATGTCGTCAATACAATGCA
    CAAGAAGCTTTAGATATGGGCCTAGTAAATACAGTGGTACCTTTAGATAAAGTTGAAGAT
    GAAACTGTGCAATGGTGTAAAGAGATTATGAAACACTCACCAACAGCTTTACGATTCCTT
    AAAGCAGCTATGAATGCTGACACAGATGGTTTAGCTGGTTTACAACAAATGGCTGGGGAT
    GCAACATTGCTTTATTACACAACTGATGAAGCGAAAGAAGGCCGTGATGCGTTTAAAGAA
    AAACGTGATCCTGACTTCGATCAATTCCCTAAATTCCCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0898 [new locus tag: SA_RS05095 ]
  • symbol: MenB
  • description: naphthoate synthase
  • length: 273
  • theoretical pI: 5.23463
  • theoretical MW: 30411.4
  • GRAVY: -0.358608

Function[edit source | edit]

  • reaction:
    EC 4.1.3.36?  ExPASy
    1,4-dihydroxy-2-naphthoyl-CoA synthase4-(2-carboxyphenyl)-4-oxobutanoyl-CoA = 1,4-dihydroxy-2-naphthoyl-CoA + H2O
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonenaphthoate synthase (TIGR01929; EC 4.1.3.36; HMM-score: 423.7)
    2-ketocyclohexanecarboxyl-CoA hydrolase (TIGR03210; EC 3.7.-.-; HMM-score: 316.2)
    phenylacetate degradation probable enoyl-CoA hydratase PaaB (TIGR02280; EC 4.2.1.17; HMM-score: 118.6)
    6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase (TIGR03200; EC 3.-.-.-; HMM-score: 101.4)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty oxidation complex, alpha subunit FadB (TIGR02437; EC 1.1.1.35,4.2.1.17,5.1.2.3,5.3.3.8; HMM-score: 57.1)
    cyclohexa-1,5-dienecarbonyl-CoA hydratase (TIGR03189; EC 4.2.1.100; HMM-score: 54.3)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty oxidation complex, alpha subunit FadJ (TIGR02440; EC 1.1.1.35,4.2.1.17,5.1.2.3; HMM-score: 48.8)
    fatty acid oxidation complex, alpha subunit, mitochondrial (TIGR02441; EC 1.1.1.35,4.2.1.17; HMM-score: 36.6)
    benzoyl-CoA-dihydrodiol lyase (TIGR03222; EC 4.1.2.44; HMM-score: 20.9)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidessignal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 13.9)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsQuinone cofactorsMenaquinone and Phylloquinone Biosynthesis Naphthoate synthase (EC 4.1.3.36) 
    Quinone cofactorsMenaquinone biosynthesis from chorismate via 1,4-dihydroxy-2-naphthoate Naphthoate synthase (EC 4.1.3.36) 
  • PFAM:
    ClpP_crotonase (CL0127) ECH_1; Enoyl-CoA hydratase/isomerase (PF00378; HMM-score: 298.8)
    ECH_2; Enoyl-CoA hydratase/isomerase (PF16113; HMM-score: 75.9)
    Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 13.9)
    NTF2 (CL0051) SnoaL_3; SnoaL-like domain (PF13474; HMM-score: 13.5)
    ClpP_crotonase (CL0127) SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 12.1)
    no clan definedDUF1666; Protein of unknown function (DUF1666) (PF07891; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: bicarbonate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 37
    • Cmax: 0.154
    • Cmax_pos: 37
    • Smax: 0.122
    • Smax_pos: 12
    • Smean: 0.079
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNRQWETLREYDEIKYEFYEGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDFDQFPKFP

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]