From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
  • pan locus tag?: SAUPAN003316000
  • symbol: SACOL1101
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
  • symbol: SACOL1101
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1111273..1111899
  • length: 627
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAATTTGGAAAAACAATCGCAGTAGTATTAGCATCTAGTGTCTTGCTTGCAGGATGT
    ACTACGGATAAAAAAGAAATTAAGGCATATTTAAAGCAAGTGGATAAAATTAAAGATGAT
    GAAGAACCAATTAAAACTGTTGGTAAGAAAATTGCTGAATTAGATGAGAAAAAGAAAAAA
    TTAACTGAAGATGTCAATAGTAAAGATACAGCAGTTCGCGGTAAAGCAGTAAAGGATTTA
    ATTAAAAATGCCGATGATCGTCTAAAGGAATTTGAAAAAGAAGAAGACGCAATTAAGAAG
    TCTGAACAAGACTTTAAGAAAGCAAAAAGTCACGTTGATAACATTGATAATGATGTTAAA
    CGTAAAGAAGTAAAACAATTAGATGATGTATTAAAAGAAAAATATAAGTTACACAGTGAT
    TACGCGAAAGCATATAAAAAGGCTGTAAACTCAGAGAAAACATTATTTAAATATTTAAAT
    CAAAATGACGCGACACAACAAGGTGTTAACGAAAAATCAAAAGCAATAGAACAGAACTAT
    AAAAAGTTAAAAGAAGTATCAGATAAGTATACAAAAGTACTAAATAAGGTTGGTAAAGAA
    AAGCAAGACGTTGATCAATTTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
  • symbol: SACOL1101
  • description: hypothetical protein
  • length: 208
  • theoretical pI: 9.96393
  • theoretical MW: 23875.2
  • GRAVY: -1.06587

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 12.8)
    and 6 more
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)
    SH3 domain protein (TIGR04211; HMM-score: 8.1)
    two transmembrane protein (TIGR04527; HMM-score: 7.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions conjugative transfer region lipoprotein, TIGR03751 family (TIGR03751; HMM-score: 5.9)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.2)
  • TheSEED  :
    • FIG01108153: hypothetical protein
  • PFAM:
    no clan defined YkyA; Putative cell-wall binding lipoprotein (PF10368; HMM-score: 171)
    and 16 more
    Mce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 18.6)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 14.1)
    BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 12.5)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 12.3)
    no clan defined BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 12.3)
    IL31; Interleukin 31 (PF15209; HMM-score: 11.7)
    TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 11.6)
    no clan defined EzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 11.2)
    DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10.4)
    DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 9.9)
    T3SSipB; Type III cell invasion protein SipB (PF16535; HMM-score: 9.8)
    CENP-H; Centromere protein H (CENP-H) (PF05837; HMM-score: 9)
    P-loop_NTPase (CL0023) AAA_13; AAA domain (PF13166; HMM-score: 8.7)
    Golgi-transport (CL0145) BAR_3; BAR domain of APPL family (PF16746; HMM-score: 7)
    no clan defined IncA; IncA protein (PF04156; HMM-score: 6.8)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: VLLAGCT
  • SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
    • SP(Sec/SPI): 0.000447
    • TAT(Tat/SPI): 0.000065
    • LIPO(Sec/SPII): 0.999242
    • Cleavage Site: CS pos: 19-20. LAG-CT. Pr: 0.9999
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKFGKTIAVVLASSVLLAGCTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKAKSHVDNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVGKEKQDVDQFK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 5.79 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]