From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • pan locus tag?: SAUPAN003450000
  • symbol: SACOL1193
  • pan gene symbol?: ftsL
  • synonym:
  • product: cell division protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • symbol: SACOL1193
  • product: cell division protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1197273..1197659
  • length: 387
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGTACCAACCATATGACGAACAAGTTTATAATAGTATACCGAAGCAACAACCACAAACT
    AAGCCCGAAAAGAAGACTGTTTCGAGAAAAGTGGTTGTACAATTAACTAAATTTGAAAAA
    GTTTTATACATAACTTTGATTACTGTAATTGCTATGTTAAGTATTTATATGCTATCTTTA
    AAAATGGATGCGTATGATACGCGAGGAAAGATTGCAGATTTAGATTATAAAATAGATAAA
    CAATCAAGTGAAAACAGTGCTTTACAATCTGAAATCAAAAAGAATTCTTCTTATGAACGC
    ATATACGAAAAGGCTAAGAAACAGGGGATGAGCCTTGAGAACGATAATGTAAAGGTAGTG
    CGTAGTAATGGCGAAGCAAAAAATTAA
    60
    120
    180
    240
    300
    360
    387

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • symbol: SACOL1193
  • description: cell division protein
  • length: 128
  • theoretical pI: 9.84873
  • theoretical MW: 14806.9
  • GRAVY: -0.730469

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 83.7)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryBacterial Cytoskeleton Cell division protein FtsL 
    Bacterial Cell Division Cell division protein FtsL 
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 50.5)
    no clan definedTmemb_9; TMEM9 (PF05434; HMM-score: 15.1)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 28
    • Cmax: 0.122
    • Cmax_pos: 65
    • Smax: 0.221
    • Smax_pos: 18
    • Smean: 0.12
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSIYMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLENDNVKVVRSNGEAKN

Experimental data[edit source | edit]

  • experimental localization: Integral membrane [1] [2] [3]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]