From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • pan locus tag?: SAUPAN003456000
  • symbol: ftsZ
  • pan gene symbol?: ftsZ
  • synonym:
  • product: cell division protein FtsZ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • symbol: ftsZ
  • product: cell division protein FtsZ
  • replicon: chromosome
  • strand: +
  • coordinates: 1205368..1206540
  • length: 1173
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGTTAGAATTTGAACAAGGATTTAATCATTTAGCGACTTTAAAGGTCATTGGTGTAGGT
    GGTGGCGGTAACAACGCCGTAAACCGAATGATTGACCACGGAATGAATAATGTTGAATTT
    ATCGCTATCAACACAGACGGTCAAGCTTTAAACTTATCTAAAGCTGAATCTAAAATCCAA
    ATCGGTGAAAAATTAACACGTGGTTTAGGAGCAGGAGCTAATCCTGAAATCGGTAAAAAA
    GCTGCAGAGGAATCTCGTGAACAAATTGAAGATGCAATCCAAGGTGCAGACATGGTATTT
    GTTACTTCTGGTATGGGTGGCGGAACTGGTACTGGTGCAGCACCAGTCGTTGCTAAAATT
    GCAAAAGAAATGGGCGCATTAACTGTTGGTGTTGTAACTCGTCCATTTAGTTTTGAAGGA
    CGTAAACGTCAAACTCAAGCTGCTGCTGGAGTAGAAGCTATGAAAGCTGCAGTAGATACA
    TTAATCGTTATACCAAATGACCGTTTATTAGATATCGTTGACAAATCTACGCCAATGATG
    GAAGCATTTAAAGAAGCTGACAACGTGTTACGCCAAGGTGTACAAGGTATCTCAGACTTA
    ATCGCTGTTTCTGGTGAAGTAAACTTAGACTTTGCAGACGTTAAGACAATTATGTCTAAC
    CAAGGTTCTGCATTAATGGGTATTGGTGTTTCTTCTGGTGAAAATAGAGCGGTAGAAGCT
    GCTAAAAAAGCAATCTCTTCTCCATTACTTGAAACATCTATCGTTGGTGCACAAGGTGTG
    CTTATGAATATTACTGGTGGCGAGTCATTGTCATTATTTGAAGCACAAGAGGCTGCTGAT
    ATTGTCCAAGATGCTGCAGATGAAGACGTTAATATGATTTTCGGTACAGTTATTAATCCT
    GAATTACAAGATGAGATTGTTGTAACAGTTATTGCAACTGGTTTTGATGACAAACCAACA
    TCACATGGTCGTAAATCTGGTAGCACTGGATTCGGAACAAGCGTAAATACTTCTAGCAAT
    GCAACTTCTAAAGATGAATCATTCACTTCAAATTCATCAAATGCACAAGCAACTGATAGT
    GTAAGTGAAAGAACACATACAACTAAAGAAGATGATATTCCTAGCTTCATTAGAAATAGA
    GAAGAAAGACGTTCAAGAAGAACAAGACGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1173

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • symbol: FtsZ
  • description: cell division protein FtsZ
  • length: 390
  • theoretical pI: 4.60363
  • theoretical MW: 41036.7
  • GRAVY: -0.230769

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein FtsZ (TIGR00065; HMM-score: 453.9)
    molybdenum cofactor synthesis domain (TIGR00177; HMM-score: 16.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiazole biosynthesis adenylyltransferase ThiF (TIGR02356; EC 2.7.7.73; HMM-score: 13.6)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryBacterial Cytoskeleton Cell division protein FtsZ (EC 3.4.24.-) 
    Bacterial Cell Division Cell division protein FtsZ (EC 3.4.24.-) 
    cell division cluster containing FtsQ Cell division protein FtsZ (EC 3.4.24.-) 
    Cell Division Cluster Cell division protein FtsZ (EC 3.4.24.-) 
  • PFAM:
    Tubulin (CL0566) Tubulin; Tubulin/FtsZ family, GTPase domain (PF00091; HMM-score: 154.2)
    Tubulin_C (CL0442) FtsZ_C; FtsZ family, C-terminal domain (PF12327; HMM-score: 116.2)
    NADP_Rossmann (CL0063) NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 12.6)
    Tubulin (CL0566) Tubulin_2; Tubulin like (PF13809; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL1198(ftsA)cell division protein FtsA  [1] (data from MRSA252)
    SACOL1103(pdhB)pyruvate dehydrogenase complex E1 component subunit beta  [1] (data from MRSA252)
    SACOL1104(pdhC)branched-chain alpha-keto acid dehydrogenase E2  [1] (data from MRSA252)
    SACOL1105(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SACOL1745(pyk)pyruvate kinase  [1] (data from MRSA252)
    SACOL2220(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SACOL1274(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    SACOL2222(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SACOL2214(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SACOL0594(tuf)elongation factor Tu  [1] (data from MRSA252)
    SACOL0731LysR family transcriptional regulator  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.155
    • Ymax_pos: 26
    • Cmax: 0.14
    • Cmax_pos: 26
    • Smax: 0.275
    • Smax_pos: 25
    • Smean: 0.166
    • D: 0.16
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDSVSERTHTTKEDDIPSFIRNREERRSRRTRR

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [2] [3] [4] [5] [6]
    quantitative data / protein copy number per cell: 4452 [7]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 198.62 h [8]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12

Relevant publications[edit source | edit]