From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1217 [new locus tag: SACOL_RS06235 ]
  • pan locus tag?: SAUPAN003485000
  • symbol: pyrE
  • pan gene symbol?: pyrE
  • synonym:
  • product: orotate phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1217 [new locus tag: SACOL_RS06235 ]
  • symbol: pyrE
  • product: orotate phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1226691..1227302
  • length: 612
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGCTAAAGAAATTGCAAAATCATTATTAGATATTGAAGCTGTAACATTATCACCAAAT
    GATTTATATACATGGAGTTCAGGTATTAAATCACCGATTTACTGTGATAACCGTGTTACG
    TTAGGTTATCCTTTAGTTCGAGGCGCAATCCGCGATGGTTTAATTAACTTAATTAAAGAA
    CACTTTCCTGAAGTAGAAGTTATTTCTGGTACTGCAACAGCTGGTATTCCACATGCAGCT
    TTTATTGCTGAAAAATTAAAATTACCAATGAATTATGTTCGTTCATCAAATAAGAGTCAT
    GGTAAGCAAAATCAAATCGAAGGTGCTAAAAGTGAAGGTAAAAAAGTAGTTGTGATAGAA
    GATTTAATTTCGACAGGGGGATCTTCAGTCACAGCAGTTGAAGCCTTAAAACTAGCAGGT
    GCAGAAGTATTAGGTGTTGTAGCTATCTTTACTTACGGTTTGAAAAAAGCAGATGATACA
    TTTAGCAATATTCAACTACCTTTTTACACTTTAAGTGATTACAATGAATTAATTGAAGTA
    GCTGAAAATGAAGGTAAAATTTCTAGTGAAGATATCCAAACATTAGTTGAATGGAGAGAC
    AACTTAGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    612

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1217 [new locus tag: SACOL_RS06235 ]
  • symbol: PyrE
  • description: orotate phosphoribosyltransferase
  • length: 203
  • theoretical pI: 4.79327
  • theoretical MW: 22042
  • GRAVY: -0.0325123

Function[edit source | edit]

  • reaction:
    EC 2.4.2.10?  ExPASy
    Orotate phosphoribosyltransferaseOrotidine 5'-phosphate + diphosphate = orotate + 5-phospho-alpha-D-ribose 1-diphosphate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 149.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 59.7)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 37.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 31)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesxanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 20.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesispur operon repressor PurR (TIGR01743; HMM-score: 19.2)
    Signal transductionRegulatory functionsDNA interactionspur operon repressor PurR (TIGR01743; HMM-score: 19.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 16.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 16.4)
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 14.2)
  • TheSEED:  
    Nucleosides and NucleotidesPyrimidinesDe Novo Pyrimidine Synthesis Orotate phosphoribosyltransferase (EC 2.4.2.10) 
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 64.7)
    UPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 14.8)
    Leu-IlvD (CL0364) Aconitase_2_N; Aconitate hydratase 2 N-terminus (PF06434; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 11
    • Cmax: 0.115
    • Cmax_pos: 29
    • Smax: 0.166
    • Smax_pos: 1
    • Smean: 0.107
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKEIAKSLLDIEAVTLSPNDLYTWSSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHFPEVEVISGTATAGIPHAAFIAEKLKLPMNYVRSSNKSHGKQNQIEGAKSEGKKVVVIEDLISTGGSSVTAVEALKLAGAEVLGVVAIFTYGLKKADDTFSNIQLPFYTLSDYNELIEVAENEGKISSEDIQTLVEWRDNLA

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3] [4]
    quantitative data / protein copy number per cell: 260 [5]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 42.87 h [6]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]