From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1575 [new locus tag: SACOL_RS08025 ]
  • pan locus tag?: SAUPAN004092000
  • symbol: SACOL1575
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1575 [new locus tag: SACOL_RS08025 ]
  • symbol: SACOL1575
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1609647..1610237
  • length: 591
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAGCAAAAAATTATTATGTTTACTCTTGTAACAGTAATATTATTTTGTGCTGTTTTA
    ATTGGTTATCAGATTCCTAAACAACAAGTTAAAATGAAACAAAATCAAATTGAAGATTTG
    CAGGAAGAACAACGTATATTAAGAGATAAAAATGGAGAGTTAAATAAATTAGTAAAGAGA
    CAATCAAAAACAGTTATTTCTGATGAAGAAAAACAAATACGTGAAGTTTCTTCAAATTTT
    GTTAAACAGATGTTTGAAATGAAAAAAGATTCTTCTTTTAAATCAAAAGCACCACAAATA
    AAGCCTTTAGTTACAAAGGATTATTACGATACATTATTTAAGGATTCTAAAGATAAATAT
    GATTTATATGATGATATAACGGTTAATGATATTCATGTTTATTTTGATACTTATGACCCT
    AAAAAAGATAGTTATAAAGTTTTTGTTCAGTTCGACGAACGTATTGAAACAGATGGAGAT
    GATAAAATTGAACATCGTCAAACATCTGCACAATTGGATTTAGTTCGTACAGCTGAAGGT
    TGGCGTATTGATAATTTAAAACGTTTTAATTTAAAACCTCTAGGACGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1575 [new locus tag: SACOL_RS08025 ]
  • symbol: SACOL1575
  • description: hypothetical protein
  • length: 196
  • theoretical pI: 9.15714
  • theoretical MW: 23315.6
  • GRAVY: -0.770918

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 5.8)
  • TheSEED:  
    hypothetical protein transposon-related 
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 16)
    no clan definedChordopox_G3; Chordopoxvirus G3 protein (PF06129; HMM-score: 14.1)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 12.6)
    no clan definedTMF_DNA_bd; TATA element modulatory factor 1 DNA binding (PF12329; HMM-score: 12.4)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 11.3)
    Oxa1 (CL0376) DUF106; Integral membrane protein DUF106 (PF01956; HMM-score: 7.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 4.6
    • Cellwall Score: 2.48
    • Extracellular Score: 2.92
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.26
    • Ymax_pos: 33
    • Cmax: 0.167
    • Cmax_pos: 33
    • Smax: 0.617
    • Smax_pos: 4
    • Smean: 0.45
    • D: 0.334
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKQKIIMFTLVTVILFCAVLIGYQIPKQQVKMKQNQIEDLQEEQRILRDKNGELNKLVKRQSKTVISDEEKQIREVSSNFVKQMFEMKKDSSFKSKAPQIKPLVTKDYYDTLFKDSKDKYDLYDDITVNDIHVYFDTYDPKKDSYKVFVQFDERIETDGDDKIEHRQTSAQLDLVRTAEGWRIDNLKRFNLKPLGR

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1] [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]