From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1601 [new locus tag: SACOL_RS08165 ]
  • pan locus tag?: SAUPAN004123000
  • symbol: SACOL1601
  • pan gene symbol?: comGA
  • synonym:
  • product: competence protein comGA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1601 [new locus tag: SACOL_RS08165 ]
  • symbol: SACOL1601
  • product: competence protein comGA
  • replicon: chromosome
  • strand: -
  • coordinates: 1633277..1634251
  • length: 975
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    TTGAAGATTCTATTTCAAGAAATAATTAATAAAGCGATAGAAATGAAAGCGAGTGATGTA
    CATTTTATTCCAGTTAAAAATGAAGTAAGTATTAAATTTAGAATTAATGATAACTTGGAG
    CAGTATGAACAAATTGGGAATAGCATTTATCAAAAGTTATTAGTTTATATGAAGTTTCAA
    GCTGGGCTTGATGTTTCTACACAGCAAGTCGCACAGAGCGGTCGATATAGTTACCTTTTC
    AATAAAATATATTTTTTGAGAATATCAACTTTACCATTGTCACTTGGCCAAGAAAGTTGT
    GTTATCAGAATTGTACCTCAATTTTTTCAACCACAGAAATCAACTTATAAATTCAATGAT
    TTTAAACACCTCATGAATAAGAAACAAGGATTACTATTGTTTAGTGGACCAACTGGTTCA
    GGAAAGAGTACATTAATGTATCAAATGGTCTCATACGCGAATAAAGCCTTGAATTTAAAT
    GTAATTTCTATAGAGGATCCTGTAGAGATGCAAATTCCTGGTATCGTCCAAATTAATGTG
    AATGATAAAGCTGGCATAAACTATGTAAATTCGTTTAAAGCTATTTTAAGATGTGATCCT
    GATGTTATTTTAATAGGTGAAATCAGAGATAAAGATGTTGCCAAGTGTGTTATACAGGCT
    AGTTTAAGTGGTCACCTTGTTCTGACTACATTGCATGCAACTGATTGTAAAGGTGCTATT
    TTAAGGCTATTAGAAATGGGCATTTCTGTACAAGAATTGATACAGGCAACTAACTTAATT
    ATAAACCAACGACTTGTAACTACTATTAAGCAACAGCGACAATTAGTATGTGAAATTCTA
    TCTCAGCAACAACTCCGATATTTCTTTTCCCATAATCATTCATTACCATCATCATTTAAG
    AACTTAGAAGATAAACTTGATGATATGACAAAAGCAGGTGTCATTTGTGAAACTACAATG
    CATAAATACATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    975

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1601 [new locus tag: SACOL_RS08165 ]
  • symbol: SACOL1601
  • description: competence protein comGA
  • length: 324
  • theoretical pI: 9.07987
  • theoretical MW: 36864.8
  • GRAVY: -0.0317901

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesistype II secretion system protein E (TIGR02533; HMM-score: 221.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein E (TIGR02533; HMM-score: 221.8)
    Cell structureCell envelopeSurface structurestype IV-A pilus assembly ATPase PilB (TIGR02538; HMM-score: 213.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype IV-A pilus assembly ATPase PilB (TIGR02538; HMM-score: 213.5)
    Cell structureCell envelopeSurface structurestwitching motility protein (TIGR01420; HMM-score: 146.5)
    Cellular processesCellular processesChemotaxis and motilitytwitching motility protein (TIGR01420; HMM-score: 146.5)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid transfer ATPase TraJ (TIGR02525; HMM-score: 84.9)
    Dot/Icm secretion system ATPase DotB (TIGR02524; HMM-score: 58.2)
    Cellular processesCellular processesConjugationP-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 57.5)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 54.5)
    helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 35.9)
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AA (TIGR02858; HMM-score: 17.1)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 14.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingputative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 14.1)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.8)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 12.2)
  • TheSEED:  
    DNA MetabolismDNA uptake, competenceGram Positive Competence Late competence protein ComGA, access of DNA to ComEA 
    DNA uptake, competenceLate competence Late competence protein ComGA, access of DNA to ComEA 
  • PFAM:
    P-loop_NTPase (CL0023) T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 192.4)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.7)
    DAP3; Mitochondrial ribosomal death-associated protein 3 (PF10236; HMM-score: 18)
    AAA_23; AAA domain (PF13476; HMM-score: 17.7)
    AAA_22; AAA domain (PF13401; HMM-score: 15.7)
    Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 15.4)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 15.4)
    AAA_30; AAA domain (PF13604; HMM-score: 15.2)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.2)
    AAA_14; AAA domain (PF13173; HMM-score: 14.8)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14.6)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.4)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 14.4)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.4)
    AAA_33; AAA domain (PF13671; HMM-score: 12.6)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.3)
    AAA_25; AAA domain (PF13481; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.89
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 18
    • Cmax: 0.12
    • Cmax_pos: 23
    • Smax: 0.215
    • Smax_pos: 11
    • Smean: 0.151
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQAGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFNDFKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINVNDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAILRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFKNLEDKLDDMTKAGVICETTMHKYI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]