From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004123000
  • symbol?: comGA
  • description?: late competence protein comGA

      descriptions from strain specific annotations:

    • late competence protein comGA
    • type II secretion system protein E
    • competence protein comGA, putative
    • Late competence protein ComGA, access of DNA to ComEA
    • comG operon protein 1. domain protein
    • type II/IV secretion system family protein
    • ComG operon protein 1
    • late competence protein, ComGA
    • putative competence protein ComGA
    • competence protein ComGA-like protein
    • putative type II secretion system protein
  • strand?: -
  • coordinates?: 4394972..4395904
  • synteny block?: BlockID0031530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1502 (comGA)
    08BA02176:
    C248_1587
    11819-97:
    MS7_1561
    71193:
    ST398NM01_1609
    ECT-R 2:
    ECTR2_1395
    ED133:
    SAOV_1544
    ED98:
    SAAV_1536
    HO 5096 0412:
    SAEMRSA15_14640
    JH1:
    SaurJH1_1636
    JH9:
    SaurJH9_1602
    JKD6008:
    SAA6008_01514
    JKD6159:
    SAA6159_01479
    LGA251:
    SARLGA251_14500
    M013:
    M013TW_1559
    MRSA252:
    SAR1621
    MSHR1132:
    SAMSHR1132_13850
    MSSA476:
    SAS1482
    Mu3:
    SAHV_1531
    Mu50:
    SAV1544
    MW2:
    MW1496
    RF122:
    SAB1416c
    ST398:
    SAPIG1609
    T0131:
    SAT0131_01638
    TCH60:
    HMPREF0772_11597 (comGA)
    TW20:
    SATW20_15400
    USA300_TCH1516:
    USA300HOU_1546
    VC40:
    SAVC_06965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
    N315            MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
    NCTC8325        MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
    Newman          MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
    USA300_FPR3757  MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
                    ************************************************************

    COL             AGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFND
    N315            AGLDVSTQQVAQSGRYSYHFNKIYFLRISTLPLSLGQESCVIRIVPQFFQQQKSTYKFND
    NCTC8325        AGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFND
    Newman          AGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFND
    USA300_FPR3757  AGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFND
                    ****************** ******************************* *********

    COL             FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
    N315            FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
    NCTC8325        FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
    Newman          FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
    USA300_FPR3757  FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
                    ************************************************************

    COL             NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
    N315            NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
    NCTC8325        NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
    Newman          NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
    USA300_FPR3757  NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
                    ************************************************************

    COL             LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
    N315            LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
    NCTC8325        LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
    Newman          LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
    USA300_FPR3757  LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
                    ************************************************************

    COL             NLEDKLDDMTKAGVICETTMHKYI
    N315            NLEDKLDDMTKAGVICETTMDKYI
    NCTC8325        NLEDKLDDMTKAGVICETTMHKYI
    Newman          NLEDKLDDMTKAGVICETTMHKYI
    USA300_FPR3757  NLEDKLDDMTKAGVICETTMHKYI
                    ********************.***