From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1625 [new locus tag: SACOL_RS08285 ]
  • pan locus tag?: SAUPAN004150000
  • symbol: cdd
  • pan gene symbol?: cdd
  • synonym:
  • product: cytidine deaminase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1625 [new locus tag: SACOL_RS08285 ]
  • symbol: cdd
  • product: cytidine deaminase
  • replicon: chromosome
  • strand: -
  • coordinates: 1656651..1657055
  • length: 405
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAGTTATCAACCTCATTATTTTCAAGAAGTTAGAAAAGCACAACAAGAATCATATTCG
    CCATACAGTCAATTTAAAGTAGGGGCTTATTTAAAAACGAAAGACGGTAGAACTTTTTAT
    GGTACCAATGTAGAAAATGCTTCTTATCCATTATCGATATGTGCTGAACGAGCTAGTTTG
    GTATCGGCAATTTCTCAAGGATACAGACCAGGTGATTTTGAATCAATAACTGTAACCGTA
    GATGCAGATAAACCGTCATCACCTTGTGGTGCATGTCGTCAAGTTTTGAAGGAATTATGT
    GATGATGATATGCCTGTGTATATGACAAATCATAAAGGAGATATGGTTATGATGACAGTC
    GCAGAGTTACTACCATTTGGATTTTCAGGAAAGGATTTAGAATAA
    60
    120
    180
    240
    300
    360
    405

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1625 [new locus tag: SACOL_RS08285 ]
  • symbol: Cdd
  • description: cytidine deaminase
  • length: 134
  • theoretical pI: 4.87847
  • theoretical MW: 14963.8
  • GRAVY: -0.430597

Function[edit source | edit]

  • reaction:
    EC 3.5.4.5?  ExPASy
    Cytidine deaminaseCytidine + H2O = uridine + NH32'-deoxycytidine + H2O = 2'-deoxyuridine + NH3
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidescytidine deaminase (TIGR01354; EC 3.5.4.5; HMM-score: 170.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidescytidine deaminase (TIGR01355; EC 3.5.4.5; HMM-score: 55.1)
    phosphonate C-P lyase system protein PhnH (TIGR03292; HMM-score: 12.4)
  • TheSEED:  
    Nucleosides and NucleotidesPyrimidinespyrimidine conversions Cytidine deaminase (EC 3.5.4.5) 
    Regulation and Cell signalingProgrammed Cell Death and Toxin-antitoxin SystemsMurein hydrolase regulation and cell death Cytidine deaminase (EC 3.5.4.5) 
  • PFAM:
    CDA (CL0109) dCMP_cyt_deam_1; Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383; HMM-score: 52.1)
    dCMP_cyt_deam_2; Cytidine and deoxycytidylate deaminase zinc-binding region (PF08211; HMM-score: 40)
    LmjF365940-deam; A distinct subfamily of CDD/CDA-like deaminases (PF14421; HMM-score: 20.2)
    no clan definedDUF2685; Protein of unknown function (DUF2685) (PF10886; HMM-score: 12.4)
    GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 12.2)
    no clan definedPhnH; Bacterial phosphonate metabolism protein (PhnH) (PF05845; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 37
    • Cmax: 0.112
    • Cmax_pos: 30
    • Smax: 0.181
    • Smax_pos: 14
    • Smean: 0.111
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASLVSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTVAELLPFGFSGKDLE

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]
    quantitative data / protein copy number per cell: 193 [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]