From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2084 [new locus tag: SACOL_RS10905 ]
  • pan locus tag?: SAUPAN005374000
  • symbol: thiM
  • pan gene symbol?: thiM
  • synonym:
  • product: hydroxyethylthiazole kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2084 [new locus tag: SACOL_RS10905 ]
  • symbol: thiM
  • product: hydroxyethylthiazole kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 2149225..2150016
  • length: 792
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAATTATCTAAATAAAATACGTATTGAAAACCCATTAACAATTTGTTATACAAACGAT
    GTAGTTAAAAATTTTACAGCGAATGGTTTATTAAGTATTGGTGCTAGCCCTGCAATGAGT
    GAAGCTCCCGAAGAAGCTGAAGAATTTTACAAAGTTGCACAAGCGCTATTAATCAATATC
    GGTACTTTAACAGCAGAAAATGAACAAGATATTATTGCGATTGCTCAAACGGCAAATGAG
    GCAGGCTTACCTATTGTATTTGACCCTGTAGCTGTTGGTGCTTCTACATATCGAAAGCAA
    TTTTGTAAATTATTATTGAAATCAGCGAAAGTATCAGTAATTAAAGGCAATGCATCTGAA
    ATATTAGCGTTGATTGATGATACAGCAACTATGAAAGGTACAGATAGTGATGCTAATCTT
    GATGCGGTTGCAATAGCGAAAAAGGCTTACGCAACATATAAAACTGCAATAGTAATCACA
    GGTAAAGAGGACGTTATTGTTCAAGATAATAAAGCCTTCGTATTAGCTAATGGATCTCCA
    TTATTAGCACGAGTAACTGGAGCTGGTTGTTTATTAGGAGGCGTTATTGCTGGATTTTTA
    TTTAGAGAAACAGAACCAGACATAGAAGCGTTAATTGAAGCGGTAAGCGTATTTAATATT
    GCTGCTGAGGTAGCTGCTGAAAATGAAAATTGTGGTGGTCCTGGTACGTTTTCACCATTG
    TTGCTTGATACGTTATATCATTTAAATGAAACAACCTATCAACAACGGATTCGTATTCAA
    GAGGTGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    792

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2084 [new locus tag: SACOL_RS10905 ]
  • symbol: ThiM
  • description: hydroxyethylthiazole kinase
  • length: 263
  • theoretical pI: 4.28293
  • theoretical MW: 28089.9
  • GRAVY: 0.176046

Function[edit source | edit]

  • reaction:
    EC 2.7.1.50?  ExPASy
    Hydroxyethylthiazole kinaseATP + 4-methyl-5-(2-hydroxyethyl)thiazole = ADP + 4-methyl-5-(2-phosphonooxyethyl)thiazole
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminehydroxyethylthiazole kinase (TIGR00694; EC 2.7.1.50; HMM-score: 256.6)
    Unknown functionGeneralYjeF family C-terminal domain (TIGR00196; HMM-score: 38.5)
    methyltransferase, MtaA/CmuA family (TIGR01463; EC 2.1.1.-; HMM-score: 13.6)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsoligosaccharide:H+ symporter (TIGR00882; HMM-score: 12.8)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCofactors, Vitamins, Prosthetic Groups, Pigments - no subcategoryThiamin biosynthesis Hydroxyethylthiazole kinase (EC 2.7.1.50) 
  • PFAM:
    Ribokinase (CL0118) HK; Hydroxyethylthiazole kinase family (PF02110; HMM-score: 256.6)
    Carb_kinase; Carbohydrate kinase (PF01256; HMM-score: 37.3)
    Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 31.6)
    no clan definedHasA; Heme-binding protein A (HasA) (PF06438; HMM-score: 12.6)
    MFS (CL0015) LacY_symp; LacY proton/sugar symporter (PF01306; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.194
    • Ymax_pos: 39
    • Cmax: 0.149
    • Cmax_pos: 39
    • Smax: 0.343
    • Smax_pos: 38
    • Smean: 0.2
    • D: 0.196
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINIGTLTAENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGTDSDANLDAVAIAKKAYATYKTAIVITGKEDVIVQDNKAFVLANGSPLLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPLLLDTLYHLNETTYQQRIRIQEVE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]