From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2352 [new locus tag: SACOL_RS12350 ]
  • pan locus tag?: SAUPAN005861000
  • symbol: tcaA
  • pan gene symbol?: tcaA
  • synonym:
  • product: tcaA protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2352 [new locus tag: SACOL_RS12350 ]
  • symbol: tcaA
  • product: tcaA protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2411156..2412538
  • length: 1383
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    ATGAAATCTTGCCCGAAGTGCGGACAACAAGCACAAGATGATGTACAGATATGTACACAA
    TGTGGACATAAATTTGATAGTCGTCAAGCATTTTATAGAAAGTCAACCGATGAAGATATA
    CAAACTAATAACATCAAGATGAGAAAAATGGTGCCTTGGGCAATTGGTTTTTTCATTTTA
    ATCTTAATTATTATATTGTTCTTTTTACTAAGAAACTTCAATTCACCTGAAGCGCAAACT
    AAAATATTAGTGAATGCGATTGAGAATAATGATAAACAAAAAGTAGCAACATTATTAAGT
    ACTAAAGATAATAAAGTAGATTCTGAAGAAGCAAAAGTATACATTAACTATATCAAAGAT
    GAAGTTGGGCTTAAGCAATTTGTCAGCGACCTTAAAAATACGGTACATAAATTGAATAAG
    AGTAAGACCAGCGTAGCTTCTTATATTCAAACCAGATCTGGTCAAAATATATTACGTGTA
    AGTAAAAATGGCACACGTTATATCTTTTTCGATAATATGAGCTTTACTGCACCTACCAAG
    CAACCAATTGTTAAACCGAAAGAAAAAACAAAATATGAGTTTAAATCTGGTGGTAAGAAA
    AAGATGGTTATAGCTGAAGCAAATAAAGTGACGCCAATAGGTAATTTTATACCGGGGACA
    TATAGAATTCCAGCTATGAAATCAACTGAGAACGGTGATTTTGCAGGCCATTTAAAATTT
    GATTTTAGACAAAGTAATTCTGAAACGGTAGATGTTACTGAAGATTTTGAAGAAGCAAAT
    ATATCTGTAACTTTAAAAGGCGATACAAAATTAAATGATAGTTCTAAAAAAGTAACTATA
    AATGACCATGAAATGGCATTTTCAAGTTCCAAAACGTATGGTCCATATCCACAAAATAAA
    GATATTACCATTTCAGCTTCAGGTAAAGCGAAAGATAAAACATTTACAACACAGACGAAG
    ACGATTAAAGCTAGCGATTTAAAATACAATACAGAGATAACTTTGAATTTTGACAGTGAA
    GATATCGAAGACTATGTTGAAAAGAAAGAAAAAGAAGAAAACAGCTTGAAGAACAAATTG
    ATAGAATTCTTTGCTGGATATTCTTTAGCGAATAATGCTGCGTTTAATCAGTCGGATTTT
    GATTTTGTATCATCATATATAAAAAAAGGATCATCTTTTTATGATGATGTAAAGAAGCGT
    GTATCTAAAGGAAGTTTAATGATGATTAGTTCACCACAAATTATAGATGCTGAAAAACAT
    GGTGATAAGATTACCGCAACCGTAAGATTAATAAATGAAAACGGTAAGCAAGTAGATAAA
    GAATATGAGCTTGAACAAGGCTCGCAAGACCGCTTGCAATTAATCAAGACATCAGAAAAA
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1383

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2352 [new locus tag: SACOL_RS12350 ]
  • symbol: TcaA
  • description: tcaA protein
  • length: 460
  • theoretical pI: 9.47124
  • theoretical MW: 52147.8
  • GRAVY: -0.655

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.8)
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 5.7)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsTeicoplanin-resistance in Staphylococcus Teicoplanin resistance associated membrane protein TcaA 
  • PFAM:
    Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 28.3)
    zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 25.3)
    UPF0547; Uncharacterised protein family UPF0547 (PF10571; HMM-score: 19.3)
    DZR; Double zinc ribbon (PF12773; HMM-score: 18.4)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.8)
    no clan definedDUF2950; Protein of unknown function (DUF2950) (PF11453; HMM-score: 14.1)
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 14)
    MBB (CL0193) OprB; Carbohydrate-selective porin, OprB family (PF04966; HMM-score: 13.8)
    no clan definedDUF1461; Protein of unknown function (DUF1461) (PF07314; HMM-score: 11.7)
    RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 11.3)
    Zn_Beta_Ribbon (CL0167) zinc_ribbon_15; zinc-ribbon family (PF17032; HMM-score: 11)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 10.3)
    Transporter (CL0375) Clc-like; Clc-like (PF07062; HMM-score: 9.6)
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 9.3)
    no clan definedYhfH; YhfH-like protein (PF14149; HMM-score: 9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 23
    • Cmax: 0.113
    • Cmax_pos: 12
    • Smax: 0.138
    • Smax_pos: 18
    • Smean: 0.097
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKSCPKCGQQAQDDVQICTQCGHKFDSRQAFYRKSTDEDIQTNNIKMRKMVPWAIGFFILILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKDEVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTKQPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKFDFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNKDITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKLIEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKHGDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

M Brandenberger, M Tschierske, P Giachino, A Wada, B Berger-Bächi
Inactivation of a novel three-cistronic operon tcaR-tcaA-tcaB increases teicoplanin resistance in Staphylococcus aureus.
Biochim. Biophys. Acta: 2000, 1523(2-3);135-9
[PubMed:11042376] [WorldCat.org] (P p)
Hideki Maki, Nadine McCallum, Markus Bischoff, Akihito Wada, Brigitte Berger-Bächi
tcaA inactivation increases glycopeptide resistance in Staphylococcus aureus.
Antimicrob. Agents Chemother.: 2004, 48(6);1953-9
[PubMed:15155184] [WorldCat.org] [DOI] (P p)
N McCallum, G Spehar, M Bischoff, B Berger-Bächi
Strain dependence of the cell wall-damage induced stimulon in Staphylococcus aureus.
Biochim. Biophys. Acta: 2006, 1760(10);1475-81
[PubMed:16891058] [WorldCat.org] [DOI] (P p)
Nadine McCallum, Ann Karen C Brassinga, Costi D Sifri, Brigitte Berger-Bächi
Functional characterization of TcaA: minimal requirement for teicoplanin susceptibility and role in Caenorhabditis elegans virulence.
Antimicrob. Agents Chemother.: 2007, 51(11);3836-43
[PubMed:17709474] [WorldCat.org] [DOI] (P p)