From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005861000
  • symbol?: tcaA
  • description?: zinc ribbon domain-containing protein

      descriptions from strain specific annotations:

    • zinc ribbon domain-containing protein
    • tcaA protein
    • teicoplanin resistance associated protein A
    • teicoplanin resistance associated membrane protein TcaA protein
    • membrane-associated protein TcaA
    • teicoplanin resistance associated membrane protein
    • teicoplanin resistance protein TcaA
    • bicyclomycin and teicoplanin resistance protein
    • Teicoplanin resistance associated membrane protein TcaA
  • strand?: -
  • coordinates?: 5936152..5937534
  • synteny block?: BlockID0046060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2352 (tcaA)
    N315:
    SA2146 (tcaA)
    NCTC8325:
    Newman:
    NWMN_2257 (tcaA)
    USA300_FPR3757:
    04-02981:
    SA2981_2295 (tcaA)
    08BA02176:
    C248_2401 (tcaA)
    11819-97:
    MS7_2374 (tcaA)
    71193:
    ST398NM01_2409
    ECT-R 2:
    ECTR2_2216
    ED133:
    SAOV_2400c
    ED98:
    SAAV_2421 (tcaA)
    HO 5096 0412:
    SAEMRSA15_22540 (tcaA)
    JH1:
    SaurJH1_2426
    JH9:
    SaurJH9_2380
    JKD6008:
    SAA6008_02393 (tcaA)
    JKD6159:
    SAA6159_02260 (tcaA)
    LGA251:
    SARLGA251_21380 (tcaA)
    M013:
    M013TW_2314
    MRSA252:
    SAR2442 (tcaA)
    MSHR1132:
    SAMSHR1132_21810
    MSSA476:
    SAS2247
    Mu3:
    SAHV_2340 (tcaA)
    Mu50:
    SAV2356 (tcaA)
    MW2:
    MW2277 (tcaA)
    RF122:
    SAB2235c (tcaA)
    ST398:
    SAPIG2409
    T0131:
    SAT0131_02543
    TCH60:
    HMPREF0772_10837 (tcaA)
    TW20:
    SATW20_24870 (tcaA)
    USA300_TCH1516:
    USA300HOU_2338 (tcaA)
    VC40:
    SAVC_10640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSCPKCGQQAQDDVQICTQCGHKFDSRQAFYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
    N315            MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
    NCTC8325        MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
    Newman          MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
    USA300_FPR3757  MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
                    ******************************:*****************************

    COL             ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
    N315            ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
    NCTC8325        ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
    Newman          ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
    USA300_FPR3757  ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
                    ************************************************************

    COL             EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
    N315            EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
    NCTC8325        EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
    Newman          EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
    USA300_FPR3757  EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
                    ************************************************************

    COL             QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKF
    N315            QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFILGTYRIPAMKSTENGDFAGYLKF
    NCTC8325        QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKF
    Newman          QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKF
    USA300_FPR3757  QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKF
                    ************************************* ******************:***

    COL             DFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNK
    N315            DFRQSNSETVDVTEDFEEANITVTLKGDTKLNDSSKKVTINDREMAFSSSKTYGPYPQNK
    NCTC8325        DFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNK
    Newman          DFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNK
    USA300_FPR3757  DFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNK
                    *********************:********************:*****************

    COL             DITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
    N315            DITISASGKAKGKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
    NCTC8325        DITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
    Newman          DITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
    USA300_FPR3757  DITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
                    ***********.************************************************

    COL             IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
    N315            IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
    NCTC8325        IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
    Newman          IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
    USA300_FPR3757  IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
                    ************************************************************

    COL             GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
    N315            GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
    NCTC8325        GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
    Newman          GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
    USA300_FPR3757  GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
                    ****************************************