From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2531 [new locus tag: SACOL_RS13260 ]
  • pan locus tag?: SAUPAN006164000
  • symbol: SACOL2531
  • pan gene symbol?:
  • synonym:
  • product: MarR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2531 [new locus tag: SACOL_RS13260 ]
  • symbol: SACOL2531
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2593131..2593565
  • length: 435
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGATCGAACGAAACAATCTCTCAATGTTTTTGTCGGAATGAATAGGGCGTTAGACACA
    TTAGAGCAAATTACAAAAGAAGACGTAAAGCGATATGGCTTAAATATTACTGAATTTGCA
    GTGCTCGAGTTGCTTTATAATAAAGGTCCGCAACCAATTCAACGTATTAGAGACCGCGTA
    TTAATTGCAAGTAGCAGCATTTCATATGTTGTAAGTCAATTAGAGGACAAAGGTTGGATT
    ACACGTGAAAAGGATAAAGATGATAAACGTGTATATATGGCTTGTTTAACTGAAAAAGGT
    CAAAGTCAAATGGCAGATATTTTCCCTAAGCATGCTGAGACATTAACAAAAGCGTTTGAT
    GTGTTAACAAAGGATGAATTAACAATCTTACAACAAGCGTTTAAGAAACTAAGTGCACAA
    TCTACAGAAGTGTAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2531 [new locus tag: SACOL_RS13260 ]
  • symbol: SACOL2531
  • description: MarR family transcriptional regulator
  • length: 144
  • theoretical pI: 8.4336
  • theoretical MW: 16515.9
  • GRAVY: -0.446528

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.4)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 35.9)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 28.5)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 23.2)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 20.5)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 15)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)
    Signal transductionRegulatory functionsDNA interactionscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)
  • TheSEED:  
    Transcriptional regulator, MarR family 
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 61.8)
    MarR_2; MarR family (PF12802; HMM-score: 42.9)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 38)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 30.8)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 30.4)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 28.3)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 26.6)
    PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 11
    • Cmax: 0.122
    • Cmax_pos: 28
    • Smax: 0.223
    • Smax_pos: 1
    • Smean: 0.137
    • D: 0.129
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRVLIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFDVLTKDELTILQQAFKKLSAQSTEV

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 83 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]