Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2532 [new locus tag: SACOL_RS13265 ]
- pan locus tag?: SAUPAN006165000
- symbol: SACOL2532
- pan gene symbol?: —
- synonym:
- product: acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2532 [new locus tag: SACOL_RS13265 ]
- symbol: SACOL2532
- product: acetyltransferase
- replicon: chromosome
- strand: +
- coordinates: 2593792..2594076
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238148 NCBI
- RefSeq: YP_187325 NCBI
- BioCyc: see SACOL_RS13265
- MicrobesOnline: 914004 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGATGATGAAAAT
AATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAACATTGATCAT
ACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTACTTAAAGCAGTT
GTTGAACACGCTCGAGAAAATAATTTGAAAATTATTGCCTCATGTTCATTTGCCAAACAT
ATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2532 [new locus tag: SACOL_RS13265 ]
- symbol: SACOL2532
- description: acetyltransferase
- length: 94
- theoretical pI: 4.54531
- theoretical MW: 10547.7
- GRAVY: -0.558511
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 23.1)and 1 moremethanogenesis imperfect marker protein 11 (TIGR03280; HMM-score: 12.3)
- TheSEED :
- Acetyltransferase (GNAT) family protein
- PFAM: Acetyltrans (CL0257) Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 89.1)and 5 moreAcetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 28.5)Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 27.8)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 17.3)NTP_transf (CL0260) Pox_polyA_pol; Poxvirus poly(A) polymerase nucleotidyltransferase domain (PF03296; HMM-score: 13.1)no clan defined DUF2312; Uncharacterized protein conserved in bacteria (DUF2312) (PF10073; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004095
- TAT(Tat/SPI): 0.000184
- LIPO(Sec/SPII): 0.000375
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 770 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 55.25 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
John R Cort, Theresa A Ramelot, Diana Murray, Thomas B Acton, Li-Chung Ma, Rong Xiao, Gaetano T Montelione, Michael A Kennedy
Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
J Struct Funct Genomics: 2008, 9(1-4);7-20
[PubMed:18709443] [WorldCat.org] [DOI] (P p)