From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006165000
  • symbol?:
  • description?: acetyltransferase-like protein

      descriptions from strain specific annotations:

    • acetyltransferase-like protein
    • acetyltransferase (GNAT) family protein
    • GNAT family acetyltransferase
    • acetyltransferase family protein
    • acetyltransferase, GNAT family protein
  • strand?: +
  • coordinates?: 6237399..6237692
  • synteny block?: BlockID0048900
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2457
    08BA02176:
    C248_2579
    11819-97:
    MS7_2527
    71193:
    ST398NM01_2573
    ECT-R 2:
    ECTR2_2373
    ED133:
    SAOV_2565
    ED98:
    SAAV_2586
    HO 5096 0412:
    SAEMRSA15_24190
    JH1:
    SaurJH1_2596
    JH9:
    SaurJH9_2544
    JKD6008:
    SAA6008_02559
    JKD6159:
    SAA6159_02417
    LGA251:
    SARLGA251_22960
    M013:
    M013TW_2492
    MRSA252:
    SAR2601
    MSHR1132:
    SAMSHR1132_23420
    MSSA476:
    SAS2406
    Mu3:
    SAHV_2505
    Mu50:
    SAV2521
    MW2:
    MW2441
    RF122:
    SAB2395
    ST398:
    SAPIG2573
    T0131:
    SAT0131_02723 (secY)
    TCH60:
    HMPREF0772_10672
    TW20:
    SATW20_26420
    USA300_TCH1516:
    VC40:
    SAVC_11480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLL
    N315            ---MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLV
    NCTC8325        ---MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLL
    Newman          MICMSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLL
    USA300_FPR3757  ---MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLL
                       ********************************************************:

    COL             KAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG
    N315            KAVVEHARENHLKIIASCSFAKHMLEKEDSYQDVYLG
    NCTC8325        KAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG
    Newman          KAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG
    USA300_FPR3757  KAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG
                    **********:**************************