From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2651 [new locus tag: SACOL_RS13885 ]
  • pan locus tag?: SAUPAN006356000
  • symbol: SACOL2651
  • pan gene symbol?: estA
  • synonym:
  • product: tributyrin esterase EstA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2651 [new locus tag: SACOL_RS13885 ]
  • symbol: SACOL2651
  • product: tributyrin esterase EstA
  • replicon: chromosome
  • strand: -
  • coordinates: 2710159..2710920
  • length: 762
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCTTATATTTCATTAAACTATCATTCACCAACAATTGGTATGCATCAAAATTTGACA
    GTCATTTTACCGGAAGATCAAAGCTTCTTTAATAGCGATACAACTGTTAAACCATTAAAA
    ACTTTAATGTTGTTACATGGATTATCAAGTGATGAAACGACATATATGAGATATACAAGC
    ATAGAAAGGTATGCGAATGAACACAAATTAGCTGTGATTATGCCCAATGTGGATCATAGC
    GCATATGCTAACATGGCATATGGTCATAGCTATTATGATTATATTTTGGAAGTGTATGAT
    TATGTTCATCAAATATTTCCACTTTCCAAAAAGCGTGATGACAATTTTATAGCAGGTCAC
    TCTATGGGAGGATATGGCACAATTAAATTTGCATTAACACAAGGGGATAAATTTGCCAAA
    GCTGTACCATTATCTGCTGTGTTTGAAGCGCAAAATTTAATGGATCTAGAGTGGAATGAT
    TTTTCAAAAGAGGCCATAATTGGCAATCTTTCAAGTGTTAAAGGAACTGAACATGATCCG
    TATTACTTGCTAGACAAAGCTGTAGCTGAAGATAAACAAATTCCAAAATTGCTCATTATG
    TGTGGTAAACAAGACTTTTTATATCAAGACAACTTAGATTTTATCGATTATTTATCACGC
    ATAAATGTTCCTTATCAATTTGAAGATGGACCAGGAGATCATGATTATGCATATTGGGAT
    CAAGCGATTAAGCGTGCTATAACATGGATGGTGAATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    762

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2651 [new locus tag: SACOL_RS13885 ]
  • symbol: SACOL2651
  • description: tributyrin esterase EstA
  • length: 253
  • theoretical pI: 4.82893
  • theoretical MW: 29095.7
  • GRAVY: -0.334387

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationS-formylglutathione hydrolase (TIGR02821; EC 3.1.2.12; HMM-score: 44.5)
    MetabolismFatty acid and phospholipid metabolismDegradationesterase, PHB depolymerase family (TIGR01840; EC 3.1.1.-; HMM-score: 19.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 16.1)
    MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferase (TIGR01392; EC 2.3.1.31; HMM-score: 13.8)
  • TheSEED:  
    Tributyrin esterase 
  • PFAM:
    AB_hydrolase (CL0028) Esterase; Putative esterase (PF00756; HMM-score: 55.8)
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 28.1)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 26.9)
    Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 16.3)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 14.1)
    Abhydrolase_5; Alpha/beta hydrolase family (PF12695; HMM-score: 13.8)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 13.6)
    DHFred (CL0387) DHFR_1; Dihydrofolate reductase (PF00186; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 25
    • Cmax: 0.118
    • Cmax_pos: 33
    • Smax: 0.199
    • Smax_pos: 23
    • Smean: 0.143
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTSIERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGHSMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDPYYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWDQAIKRAITWMVND

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 58 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]