From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006356000
  • symbol?: estA
  • description?: tributyrin esterase

      descriptions from strain specific annotations:

    • tributyrin esterase
    • tributyrin esterase EstA, putative
    • esterase family protein
    • putative esterase
    • prolyl oligopeptidase family protein
    • acetyl esterase
  • strand?: -
  • coordinates?: 6389470..6390231
  • synteny block?: BlockID0050650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2528 (estA)
    USA300_FPR3757:
    04-02981:
    SA2981_2568
    08BA02176:
    C248_2697
    11819-97:
    MS7_2634
    71193:
    ST398NM01_2678
    ECT-R 2:
    ECTR2_2483
    ED133:
    SAOV_2678c
    ED98:
    SAAV_2698
    HO 5096 0412:
    SAEMRSA15_25340
    JH1:
    SaurJH1_2709
    JH9:
    SaurJH9_2653
    JKD6008:
    SAA6008_02688
    JKD6159:
    SAA6159_02525
    LGA251:
    SARLGA251_24010
    M013:
    M013TW_2610
    MRSA252:
    SAR2708
    MSHR1132:
    SAMSHR1132_24530
    MSSA476:
    SAS2515
    Mu3:
    SAHV_2613
    Mu50:
    SAV2629
    MW2:
    MW2550
    RF122:
    SAB2504c
    ST398:
    SAPIG2678
    T0131:
    SAT0131_02892 (asd)
    TCH60:
    HMPREF0772_10560 (estA)
    TW20:
    SATW20_27670
    USA300_TCH1516:
    USA300HOU_2629
    VC40:
    SAVC_12025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTS
    N315            MAYISLNYHSPTIGMHQNLTVILPEDQSFFNNDITAKPLKTLMLLHGLSSDETTYMRYTS
    NCTC8325        MAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTS
    Newman          MAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTS
    USA300_FPR3757  MAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTS
                    *******************************.* *.************************

    COL             IERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGH
    N315            IERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGH
    NCTC8325        IERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGH
    Newman          IERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGH
    USA300_FPR3757  IERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGH
                    ************************************************************

    COL             SMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDP
    N315            SMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDP
    NCTC8325        SMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDP
    Newman          SMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDP
    USA300_FPR3757  SMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDP
                    ************************************************************

    COL             YYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWD
    N315            YYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRKNVPYQFEDGPGDHDYAYWD
    NCTC8325        YYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWD
    Newman          YYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWD
    USA300_FPR3757  YYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWD
                    **************************************** *******************

    COL             QAIKRAITWMVND
    N315            QAIKRAITWMVND
    NCTC8325        QAIKRAITWMVND
    Newman          QAIKRAITWMVND
    USA300_FPR3757  QAIKRAITWMVND
                    *************