From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02105 [old locus tag: SACOL0418 ]
  • pan locus tag?: SAUPAN001890000
  • symbol: SACOL_RS02105
  • pan gene symbol?: tatA
  • synonym:
  • product: twin-arginine translocase TatA/TatE family subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS02105 [old locus tag: SACOL0418 ]
  • symbol: SACOL_RS02105
  • product: twin-arginine translocase TatA/TatE family subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 424528..424752
  • length: 225
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (424528..424752) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    TTGATTATCATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTC
    GTCATTAGCATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGT
    GCCATCGGTTCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCT
    CACGATACACCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG
    60
    120
    180
    225

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS02105 [old locus tag: SACOL0418 ]
  • symbol: SACOL_RS02105
  • description: twin-arginine translocase TatA/TatE family subunit
  • length: 74
  • theoretical pI: 9.23936
  • theoretical MW: 8159.47
  • GRAVY: -0.0378378

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtwin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 67.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtwin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.3)
  • TheSEED:
  • PFAM:
    no clan definedMttA_Hcf106; mttA/Hcf106 family (PF02416; HMM-score: 68.6)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 13
    • Cmax: 0.176
    • Cmax_pos: 27
    • Smax: 0.408
    • Smax_pos: 7
    • Smean: 0.357
    • D: 0.256
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001794540 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS02105 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]